(data stored in ACNUC7421 zone)

EMBL: CP000462.PE331

CP000462.PE331       Location/Qualifiers
FT   CDS_pept        complement(372631..373683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0355"
FT                   /product="HlyD family secretion protein"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39916"
FT                   /db_xref="GOA:A0KF62"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF62"
FT                   /protein_id="ABK39916.1"
FT                   /translation="MSQHKKIPLLAAMILALLGLLFAGYWYLHGRYFESTDNAYLQSEV
FT                   TGIGSKLSGYISEVLVTDNQPVKAGQLIARLDDREYKTKVAEAEADLRLNQATAENLAA
FT                   TRTQQLSLIRQAEAKVSSANAEQVRAQQQVRRVSQLNQRHYSSQDSLDEVRAGLQVNQA
FT                   QEQEAKAALQAARERLLVLDAEAKQNQAKLALSAAQLEQAKLELAYTELRAPADGIIGK
FT                   RSLRAGLYVQSGMQVASLVPLQQVWVEANFKETQLLHMQPGQKVEVILDAYPDQPVEGI
FT                   IDSLAPATGAKFALLPPENATGNFTKIVQRVPVKIRIPEPGPLAGKLLPGLSTEVIVDT
FT                   RSPDPVVAAH"
     atgagtcaac acaagaagat ccccctgctg gcagccatga tcctggccct gctcggcctg        60
     ctgtttgccg gttactggta tctgcacggc cgctatttcg agagcaccga caacgcctac       120
     ctgcagagcg aggtcaccgg catcggttcc aagctgtccg gctacatcag cgaagtgctg       180
     gtgaccgaca accagccggt gaaggccggc cagctcatcg cccgcctcga cgaccgggag       240
     tacaagacca aggtggccga ggccgaagcc gacctgcgcc tcaatcaggc gacggcggaa       300
     aatctcgccg ccacccgcac ccagcagctg agcctcattc gccaggccga agccaaggtc       360
     agctcggcca atgccgaaca ggtgcgggcc cagcaacagg tgcgccgcgt cagccagctc       420
     aaccagcgcc actacagctc ccaggacagc ctggacgagg tgcgggccgg cctgcaggtc       480
     aaccaggccc aggagcagga ggccaaagcc gccctgcagg ccgcccgcga gcggctgctg       540
     gtgctggatg ccgaggccaa gcagaaccag gccaagctgg cattgagcgc cgcccagctg       600
     gagcaggcca agctggagct ggcctatacc gagctgcggg caccggccga cggcatcatc       660
     ggcaagcgca gtctgcgggc ggggctctac gtccagtccg gcatgcaggt ggccagcctg       720
     gtgccgctgc agcaggtgtg ggtcgaggcc aacttcaagg agacccagct gctccacatg       780
     cagcccggcc agaaggtgga ggtgatcctg gatgcctatc cggatcagcc ggtcgagggg       840
     atcatcgaca gcctggcccc cgccaccggc gccaagttcg ccctgctgcc gccggagaac       900
     gccaccggca acttcaccaa gatcgtgcaa cgggtgccgg tcaagatccg cattccggag       960
     ccggggccgc tggcgggcaa gctgctgccg ggcctatcca ccgaggtgat cgtcgacacc      1020
     cgcagccctg atcccgtggt cgcggcccac tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page