(data stored in ACNUC7421 zone)

EMBL: CP000462.PE332

CP000462.PE332       Location/Qualifiers
FT   CDS_pept        373780..374682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0356"
FT                   /product="transcriptional regulators, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35852"
FT                   /db_xref="GOA:A0KF63"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF63"
FT                   /protein_id="ABK35852.1"
FT                   /translation="MDLNAALILVRIVDKGSFTAAAQELGMTKATVSRRIAELEQRLGV
FT                   RLLYRSTRQLTLTEAGEQYYLRCSKAVDELAQAELMVSASQQEVTGTLKLAVPIEAGQL
FT                   VVGRLVAEFLQAYPGLQVELELTNRIVDPINEGLDAIVRIGDMSDSNLAARRLWSNARL
FT                   ICASPAYLARSPAITHPEDLVHHERVAVTSGFLASHWCFERDDKEVLVDPPSRFRVNNI
FT                   TCAREAAKAGLGLASLPAMLCHEELASGTLVSVLPEWQQPRVPIYLLFPERRLMPRKLR
FT                   VFIDFIVAKGADYGIDTLL"
     atggatctga acgctgcatt gattctagtg cggatcgtcg acaagggttc cttcacggcg        60
     gccgcccagg agctgggcat gaccaaggcg acggtgagcc ggcgcatcgc cgagctggag       120
     cagcgcctcg gcgtgcggct gctctaccgt tcgacccgcc agctcaccct gaccgaggcc       180
     ggcgagcagt actatctgcg ctgcagcaag gcagtggacg agctggccca ggccgagctg       240
     atggtgagtg ccagccagca ggaggtgacc ggcaccctca agctggcggt acccatcgag       300
     gcagggcagc tggtggtggg caggctggtg gcggagtttt tgcaggccta tcccggcctg       360
     caggtggagc tggagctgac caatcgcatc gtggatccca tcaacgaggg gctggatgcg       420
     atcgtgcgga tcggcgacat gagcgattcg aacctggcgg cgcggcggct gtggagcaac       480
     gcccgcctga tctgtgccag tccggcgtac ctggcgcgca gccccgccat cacccatccc       540
     gaggatctgg tgcatcatga gcgggtggcg gtgaccagcg gctttctggc gtcgcactgg       600
     tgcttcgagc gggatgacaa ggaggtgctg gttgaccctc cctcccgctt tcgggttaat       660
     aatataacct gtgccagaga ggcggcgaag gccgggctgg ggctcgcctc cctgcccgcc       720
     atgctctgcc acgaggagct ggcgagcggg accctggtgt ccgtgctgcc cgagtggcag       780
     cagcccaggg tgccgattta cctgctgttt ccggaacggc ggttgatgcc gcgaaaattg       840
     cgggtgttca tcgacttcat cgtggccaag ggggccgact acggcatcga tactctgctg       900
     tag                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page