(data stored in ACNUC7421 zone)

EMBL: CP000462.PE334

CP000462.PE334       Location/Qualifiers
FT   CDS_pept        complement(375068..376387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0358"
FT                   /product="proton/glutamate symporter"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36975"
FT                   /db_xref="GOA:A0KF65"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF65"
FT                   /protein_id="ABK36975.1"
FT                   /translation="MPPQTEYKDIGVMLFHGLAFKPWRIWTRRPLWLKTLLGMLTGIGL
FT                   GAGFSEQALLLKPIGVLFVNTIQMLMVPLIFCSVIAGLTSLLKGKTLDRIAGKAIGLYL
FT                   CSTAVAICIGLMMGWLLEPGMGANMGPYERVGMAESPTLASVLSHLVPRNPVQAMVDGK
FT                   ILQVIVFAVALALALNATGRRGRPAILFFTSLAEGMFKLTQMVMALAPYGVCALMAWMT
FT                   GKYGMSLLLPLLKVIGAVYLGCLLHVLGVYSSLLILLARLNPLHYFKSIVDAQAVAFTS
FT                   SSSNSTLPISLACAERRLGVSPAITAKVLPIGATINMDGTALYQGVTALFVAQAFGVDL
FT                   HMVDYLTIISIATLASIGTAGTPGTGLMLLTLTLTAVGLPLEGVALIAGIDRILDMART
FT                   TVNVSGDILVSVLIARSERELDLATYHDASAGEDIDFTLR"
     ttgccaccgc agaccgaata taaggacatt ggcgtcatgc tgttccatgg actggctttc        60
     aagccctggc ggatctggac ccgccgcccg ctctggttga agaccctgct cggcatgctg       120
     acggggatcg ggctcggcgc cggtttcagc gagcaggcgt tgctgctcaa gcccatcggc       180
     gtgctgttcg tcaacaccat ccagatgctg atggtgcccc tcatcttctg ctcggtcatc       240
     gccggcctca cctcgctgct caagggcaag accctcgatc ggatcgccgg caaggccatc       300
     ggcctctacc tctgctccac cgccgtcgcc atctgcatcg gcctgatgat gggctggctg       360
     ctggagcccg gcatgggcgc caacatgggg ccctatgagc gggtcggcat ggcggaatcc       420
     cccaccctag ccagcgtgct aagccacttg gtgccgcgca acccggtgca ggccatggtg       480
     gatggcaaga tcctgcaggt gatcgtgttc gcagtggccc tcgccctcgc cctcaacgcc       540
     accggtcggc gcggtcgccc cgccatcctg ttcttcacct cgctggcgga ggggatgttc       600
     aagctgaccc agatggtgat ggcactggcc ccttacggcg tctgcgccct gatggcctgg       660
     atgaccggca agtacggcat gagcctgctg ctgccgctgc tcaaggtgat cggtgccgtc       720
     tacctcggct gcctgctgca cgtgctcggc gtctacagca gcctgctgat cctgctggcc       780
     cgcctcaatc cgctgcacta cttcaagagc atcgtcgatg cccaggcggt ggccttcacc       840
     agcagttcca gcaacagcac cctgcccatc agcctggcct gcgccgagcg ccggctcggg       900
     gtctctcccg ccatcaccgc caaggtgctg cccatcggcg ccaccatcaa catggatggc       960
     accgcgctct atcaaggggt taccgccctg ttcgtggccc aggccttcgg ggtggatctg      1020
     cacatggtgg attacctgac catcatcagc atcgcgacct tggccagcat cggcacggcg      1080
     ggcacgccag gcaccggcct gatgctgctg acgctgacgc tgactgcggt gggactgccg      1140
     ctggaagggg tggcgctgat cgccgggatc gaccggatcc tcgacatggc gcgcaccacg      1200
     gtcaacgtct ccggcgatat tctggtatcc gtgttgattg cccgcagcga gcgggaactg      1260
     gatctggcga cctatcacga cgccagcgcg ggcgaggaca tcgacttcac cctgcgctga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page