(data stored in ACNUC7421 zone)

EMBL: CP000462.PE335

CP000462.PE335       Location/Qualifiers
FT   CDS_pept        376422..376805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0359"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37584"
FT                   /db_xref="InterPro:IPR019620"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF66"
FT                   /protein_id="ABK37584.1"
FT                   /translation="MPHYRQSRGHHQYGRREIGNLLAYIKVVGSGAGFNRHQICLFKRF
FT                   AMTQSVHGHEVMEMMLAHGGQFTRASLKQAIDERFGAEARFHTCSASEMDAEALIDFLA
FT                   KRGKFIESEQGFQTHADKICNHG"
     ttgccacatt atcgacaaag ccgcggccat caccagtacg gacgcaggga aatcggcaat        60
     ttgttggcct atatcaaggt cgtcggcagt ggggcaggat ttaataggca tcaaatatgt       120
     ctattcaaga ggtttgcaat gactcaatcg gtacacggtc acgaagtgat ggagatgatg       180
     ctggcgcatg gcggccagtt tacccgggcc agcctcaagc aggccatcga cgagcgcttc       240
     ggtgccgagg ctcgtttcca cacctgcagc gccagcgaga tggatgccga ggccctgatc       300
     gacttcctgg ccaagcgcgg caagttcatc gaatcggagc agggtttcca gactcacgcc       360
     gacaagatct gcaaccacgg ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page