(data stored in ACNUC7421 zone)

EMBL: CP000462.PE345

CP000462.PE345       Location/Qualifiers
FT   CDS_pept        complement(385259..385570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39835"
FT                   /db_xref="GOA:A0KF76"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF76"
FT                   /protein_id="ABK39835.1"
FT                   /translation="MKRVFNLLAMGLILFFWFGVLVSLIAPLPGKLNGFLPVCGVIVAL
FT                   MHWVQASMVKAACKPYFAVSRLEFTQVLVFGVFGMVEIRTRLQAIVDAKQRGTDNKAG"
     atgaagcggg tgtttaatct gttggcgatg ggcctcatcc tgttcttctg gttcggcgtg        60
     ctggtcagcc tgattgcccc gctgccgggc aaactcaacg gctttctgcc ggtgtgcggc       120
     gtgatcgtag ccctgatgca ctgggtgcag gccagcatgg tcaaggcggc ctgcaagccc       180
     tacttcgcgg tgagccggct cgagttcacc caggtgctgg tgttcggggt gttcggcatg       240
     gtggagatcc gcaccaggct gcaggccatc gtcgatgcca aacagcgcgg cacagacaac       300
     aaagccgggt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page