(data stored in ACNUC7421 zone)

EMBL: CP000462.PE346

CP000462.PE346       Location/Qualifiers
FT   CDS_pept        complement(385681..386310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0370"
FT                   /product="methyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39151"
FT                   /db_xref="GOA:A0KF77"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF77"
FT                   /protein_id="ABK39151.1"
FT                   /translation="MPRVKSSRNGPSKSPAPQGKSGFVRIISGQWRGRKLPVRDVEGLR
FT                   PTTDRVKETIFNWLAPHVRGTRCLDLFAGSGGLGLEALSRYAEQVTLIEMDKGAADQIK
FT                   KNLTTLGSSQGQVIQSDAVSWLQGPATPFDLVFLDPPFRRELLPQVCELLEQRGWLAPD
FT                   ALIYLEREKEMADLPLPASWQLLKDKQAGQVCYQLYLRDTKHDAAV"
     atgcccagag tgaaatccag ccgtaacggc ccgagcaaga gcccagcccc gcaggggaaa        60
     tcgggctttg taagaatcat cagcggtcag tggcgaggcc gcaaactgcc ggtcagggat       120
     gtggaaggac tcagacccac cacggatcgc gtcaaggaga ccatcttcaa ctggctggct       180
     ccgcatgtcc gtggcacccg ctgtctggat ctgttcgccg gcagcggcgg cctggggctg       240
     gaggcgctgt cgcgctatgc cgagcaggtc accctgatcg agatggacaa gggcgccgcc       300
     gaccagatca agaagaacct gaccaccctt ggcagcagcc agggccaggt gatccagtcc       360
     gatgccgtca gctggctgca ggggccggcc acgccgttcg atctggtgtt tctggatccc       420
     ccctttcgcc gcgagctgct gcctcaggtg tgcgagctgc tggagcaacg cggctggctg       480
     gcaccggacg ccctcatcta tctggagcgg gagaaggaga tggccgatct gccgctgccg       540
     gccagctggc aactactcaa ggacaaacag gcaggccagg tctgctatca gctctatctg       600
     cgagacacca agcatgacgc tgcggtttaa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page