(data stored in ACNUC7421 zone)

EMBL: CP000462.PE349

CP000462.PE349       Location/Qualifiers
FT   CDS_pept        389081..390034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0373"
FT                   /product="cell division membrane protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37573"
FT                   /db_xref="GOA:A0KF80"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF80"
FT                   /protein_id="ABK37573.1"
FT                   /translation="MAIVRHKQPPLRRFMMYWVDHARQAFSSLGELWRNPLASLMTLAV
FT                   LGVSLALPSCFHVLLKNAEVVEGSWQTSSQISLYLRKDLPEQNILDMKQRILLYPEVES
FT                   VTYMSRDEALKEFREISGFGDALDYLDSNPLPPVLSVIPDPRWQNPEGAAELLNKLNNE
FT                   DGVEQGKLDLQWLTRLQGIMNLLRHTITGIAVLLLSAVLLIVGNTLRLNILNQRSEIEV
FT                   LKLVGATDAFIHRPFLYTGIWFGVIGGMLAWWLTEVMVIWSEGVVKELAGLYNSNFRLV
FT                   GMGAVDGINLILLGALLGLIASWFSVHRHIRDIEPS"
     atggctattg ttcgtcataa acagccaccg ctacggcgct tcatgatgta ctgggtcgac        60
     cacgcccggc aggctttttc cagcctgggg gagctgtggc gcaacccgct cgcctcgctg       120
     atgacgctag cggtgctggg ggtcagcctg gcgctgccct cctgtttcca cgtgctgctg       180
     aaaaacgccg aggtggtgga gggcagctgg cagaccagct cccagatctc cctctatctg       240
     cgcaaggatc tgcccgagca gaacatcctc gacatgaaac agcggatcct gctctacccg       300
     gaggtggagt cggtcaccta catgagccgg gatgaggcgc tcaaggagtt tcgcgagatc       360
     tccgggtttg gcgatgcgct cgactacctc gacagcaacc cgctgccgcc ggtgctgagc       420
     gtgatcccgg atccgcgctg gcagaacccg gaaggggcgg ccgagctgct caacaagctc       480
     aacaacgaag acggggtgga acagggcaag ctggatctgc agtggctgac ccggctgcag       540
     gggatcatga acctgctgcg tcacaccatc accggcatcg cggtactgct gctctccgcc       600
     gtgctgctga tcgtcggcaa cacgctcagg ctgaatattc tcaaccagcg ctccgagatc       660
     gaagtgctca agctggtggg ggcgaccgat gccttcatcc atcgtccttt cctttatacc       720
     ggcatctggt tcggggtcat cggtggcatg ctggcctggt ggttgaccga ggtgatggtg       780
     atctggagcg aaggggtggt gaaggagctg gccggcctct acaacagcaa cttccggctg       840
     gtggggatgg gggcggtgga cgggatcaac ctgatcctgc tgggcgcctt gctggggctg       900
     atcgcctcct ggttttcggt ccatcgtcac attcgcgaca tcgaaccgtc ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page