(data stored in ACNUC7421 zone)

EMBL: CP000462.PE351

CP000462.PE351       Location/Qualifiers
FT   CDS_pept        391471..392130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0375"
FT                   /product="carbonic anhydrase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36352"
FT                   /db_xref="GOA:A0KF82"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF82"
FT                   /protein_id="ABK36352.1"
FT                   /translation="MKLLNDLFTNNREWAERIKAEDPEFFATLSAQQAPEYLWIGCSDS
FT                   RVPANQLMGLLPGDVFVHRNVANLVVHTDFNCLSVLQYAVEVLKVKHIIVCGHYGCGGV
FT                   KAAMQNQELGLIDNWLRNIKDVYFKYREQLDAIEDEHERFDYLCELNVAEQVANVCHTT
FT                   IIQNAWRKGQELAVHGWIYGIKDGLLHDLDLCISGPEQIPDVYRAWPDMRPPHRRR"
     gtgaaactct tgaacgactt gtttaccaac aaccgcgagt gggcggaacg gatcaaggcc        60
     gaggatcccg aattctttgc taccctctcc gcccagcagg cccccgaata cctctggatc       120
     ggctgctccg acagccgggt acccgccaac cagctgatgg ggctgctgcc gggggacgtg       180
     ttcgtccacc gcaacgtcgc caacctggtg gtgcacaccg acttcaactg cctctcggtg       240
     ctgcaatacg cggtcgaggt gctcaaggtg aagcacatca tcgtctgcgg ccactacggc       300
     tgcggcggcg tcaaggcggc gatgcagaac caggagctgg ggctcatcga caactggctg       360
     cgcaacatca aggatgtcta cttcaagtat cgcgagcagc tggatgccat cgaggatgag       420
     cacgagcgct tcgactacct gtgcgagctg aacgtggccg agcaggtggc caacgtctgt       480
     cacaccacca tcatccagaa cgcctggcgc aagggtcagg agctggcggt acacggctgg       540
     atctacggca tcaaggacgg tctgctgcac gatctcgatc tctgcatcag cgggcccgag       600
     cagatcccgg acgtctatcg cgcctggccg gacatgcgtc cgccccaccg ccgtcgctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page