(data stored in ACNUC7421 zone)

EMBL: CP000462.PE357

CP000462.PE357       Location/Qualifiers
FT   CDS_pept        complement(398545..399642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0381"
FT                   /product="calcium/proton antiporter"
FT                   /note="identified by match to protein family HMM PF01699"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36479"
FT                   /db_xref="GOA:A0KF88"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF88"
FT                   /protein_id="ABK36479.1"
FT                   /translation="MKSFIRQEIALPVGLLTLLFFKTLGSDLLTEATPLGIYLPVSAML
FT                   LAIVTWAIFSVVRHSDALAIKLGEPFGTLILTLSVISLEVVMISSVMLTGEPNPVMARD
FT                   TMFAVVMLVTNGLVGFTLLFGGWRYHTQSFNLDGVKSYLVAIIPLALLCLVLPNFTEGG
FT                   NIGSMSSAMSWMLIIISVLLYGVFLLIQTRSHSHFFIDSDHEDYEEHHGPLQSNVYHTL
FT                   LLLAYLVVVILLAKTLAIPINHGVKVLAAPPALGGFIVACIVLAPEAVGAIKAAFNNQL
FT                   QRAMNLYFGSVLATIALTVPAVLFIGAMLGQEVRLGLSAADMVLLFTTLMVCKVTFSSG
FT                   RTNVLHGATHLVLFVVYLFLMFEHE"
     atgaagtcat ttatccggca agagattgcc ctgcccgttg gcctgctcac cctgctcttt        60
     ttcaagacgc tcggcagcga cctgctgaca gaggccactc cgctcgggat ttatcttcct       120
     gtctcggcga tgctgcttgc catcgtcacc tgggccatct tctcggtggt gcgccactcg       180
     gatgcccttg ccatcaagct tggcgagcct tttggcaccc tgatcctcac cctgtcggtc       240
     atctcgctgg aagtggtgat gatctcctcg gtcatgctga ccggcgaacc caatccggtg       300
     atggcccgcg acaccatgtt tgccgtggtg atgctggtga ccaacggcct ggtgggcttc       360
     accctgctgt tcggcggctg gcgctaccac acccagagct tcaatctgga cggagtcaaa       420
     tcctatctgg tggccatcat tccgctggcg ctgctctgcc tggtgctgcc caacttcacc       480
     gaagggggca acatcggcag catgtcgagc gccatgtcct ggatgctgat catcatctcg       540
     gtgctgctct acggcgtctt cctgctgatc cagacccgca gccacagcca cttcttcatc       600
     gacagcgatc acgaagatta cgaagaacac cacggcccgc tgcagagcaa cgtctaccac       660
     accctgttgc tgctcgccta tctggtggtg gtgatcctgc tggccaagac cctcgccatt       720
     cccatcaacc acggggtcaa ggtactggcg gcgccgccgg cgctgggcgg cttcatcgtc       780
     gcctgtatcg tgctggcccc cgaggcggtc ggcgccatca aggccgcctt caacaatcag       840
     ctgcagcggg ccatgaacct ctacttcggc tctgtgctgg ccaccatcgc cctcaccgtg       900
     cctgcggtgc tgttcatcgg cgccatgctg gggcaagaag ttcgcctggg cctctccgcc       960
     gccgacatgg tgctgctgtt taccaccctc atggtgtgca aggtgacctt cagcagcggc      1020
     cgcaccaatg tgctgcacgg ggccactcac ctggtgctgt tcgtggtgta cctgttcctg      1080
     atgttcgagc acgaataa                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page