(data stored in ACNUC7421 zone)

EMBL: CP000462.PE358

CP000462.PE358       Location/Qualifiers
FT   CDS_pept        complement(399804..401171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0382"
FT                   /product="EAL domain protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38015"
FT                   /db_xref="GOA:A0KF89"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF89"
FT                   /protein_id="ABK38015.1"
FT                   /translation="MDESIRAQLAQFTFDCGQKDMALLRDPRFYSRHIRIQGLKLASGT
FT                   GCSSLGVDLPFTAADLPPYPSQELFGLAATQARFNTEQELVAYFHVGNNTAYWVLNNSW
FT                   SHALLQYPCTDCFYLEFHQQTPDEAMPVFPRGNKSIKEEGGSQSLSFFDPNNHIKQTLW
FT                   AGKALEHYAQQQARHYGFWGGAAVGALLVAAYWGLRNYRRSLKGLLQAGLARREFVPFY
FT                   QPVVDSRSLQVVGFEALLRWQRGGDLIPPGAFIDYAEEQQLILPMTSQLLEKVIADLPR
FT                   LAPGQWVSVNIVAAHLEHPHLRNLLLQHGWPSPAQLTFELTERKPITDIKTAVIEITAL
FT                   QQQGYHFKLDDFGTGYGGFAYLQRLGIRQIKIDKMFVDTIGTDDLKRSVLDATIAFGRE
FT                   SGMEMIAEGVERQDQVDYLQQHGVHLIQGYVYAQPMALTKLKIWLLAWYQNHTGER"
     ttggacgaga gcattcgcgc tcaactagcc cagttcacgt ttgactgtgg tcaaaaggac        60
     atggcgctgt tgcgggatcc ccgtttctac agccgtcaca tccgcatcca ggggctcaag       120
     ctcgcctcgg gtactggctg ctccagtctg ggggtggacc tgcccttcac cgccgccgat       180
     cttcctccct atcccagcca ggagctgttc ggtctcgcag ccacccaggc ccgcttcaac       240
     acggaacagg agctggtcgc ctattttcac gtagggaaca ataccgccta ctgggtacta       300
     aacaacagct ggagccatgc gctgttgcaa tacccctgca ccgactgttt ctacctcgaa       360
     ttccaccagc agacaccgga cgaggcaatg ccggttttcc cccgcggcaa caagtccatc       420
     aaggaagaag gggggagcca gagtctgagc ttctttgatc ccaacaatca catcaagcag       480
     accctgtggg caggcaaagc gctggaacac tacgcccagc agcaggcccg ccactacggg       540
     ttctggggcg gcgcggcggt cggggccctg ctggtcgccg cctactgggg gctgcgcaac       600
     taccggcgct cgctcaaagg gttgctgcaa gccgggctgg cacggcggga gttcgtgccc       660
     ttctatcaac ccgtggtcga cagccgcagc ctacaggtgg tgggcttcga ggcgctactg       720
     cgctggcagc ggggtggtga cctgatcccg cccggcgcct tcatcgacta tgcagaggag       780
     cagcagctga tcctgccgat gaccagccag ctgctggaaa aggtgatcgc ggatctgccc       840
     aggctcgccc ccggccagtg ggtcagcgtc aacatagtgg ccgcccacct cgagcacccg       900
     catctgcgca acctgctgtt gcagcacggc tggccctctc ccgcccagct caccttcgag       960
     ctgaccgagc gcaagcccat caccgacatc aagacagccg tcatcgagat caccgcattg      1020
     cagcagcagg gctaccactt caagctggat gacttcggca ccggttacgg cggcttcgct      1080
     tacctgcagc ggctcggcat ccgccagatc aagatcgaca agatgttcgt cgacaccata      1140
     ggcaccgacg acctcaagcg cagcgtgctg gatgccacca tcgccttcgg ccgcgagtcg      1200
     ggcatggaga tgatcgccga aggggtcgag cgccaggatc aggtcgacta tctgcagcag      1260
     cacggcgtgc acctgatcca gggctatgtc tatgcacagc ccatggcgct gaccaagctg      1320
     aaaatctggc tgctggcctg gtaccagaac cacacgggcg agcgatga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page