(data stored in ACNUC7421 zone)

EMBL: CP000462.PE359

CP000462.PE359       Location/Qualifiers
FT   CDS_pept        401850..403808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0383"
FT                   /product="msha biogenesis protein mshh"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39510"
FT                   /db_xref="GOA:A0KF90"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033423"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF90"
FT                   /protein_id="ABK39510.1"
FT                   /translation="MDVVGHTERHMKLTTQLVSFITLCVIAAMAMVLLGGVFSFRELGM
FT                   EMQQKKVNSLVEIIDKQLEVADDHQDLTRWLPTLLRSAHVVELEIRQDKQRIYWFRDVQ
FT                   QPTDESLLIPYHQPMPHQPGMQADFKLERPFKEFEYSIKAMSGISLGVFIVVFGLWYSI
FT                   RWLRLQLRGAELLAERAQLILDNKLTKLAHDPADEWPQPASQALDYLLAELADARKERS
FT                   RFDNFIRSNAFVDKMTGIGNRLFFDNRLESAIMEASVMSGGVLLIELAGLEELDPELNG
FT                   RQSQDLLMEASASIAAFVRKHNGALQARYAGQVFAVLLPNMSESEMVDGAGQLHKSLQR
FT                   LHWPEAVNPDTAVYLGAVCYQAEDSLLKVQEEAELALKSARLQGHTGWFLYEKQLDEEQ
FT                   SSKGTVRWRTLIGRRIEEHGIDFYVQPVQQERDQVVLQQDLLIRIHDEQGRELQAGVFM
FT                   PMAEKAGLLLPLDRLVAEQTLGLLRQRSEQSCPISLTLCAQSLLHREFQRWLFFDLFQL
FT                   PRSTNERLILQLSEAQVTRHYEALKRPLRALRMLGCQLAIDHAGQDVVSTQYIKEFEIN
FT                   FLKLHPSLVREIHTRQVNQMAVRSLVGGCANTRTRVIAVGVESGDEWKMLRHLGVHAGQ
FT                   GPWFAEPERLVLEPAGA"
     atggatgttg tcgggcatac ggaaaggcac atgaaactga ccactcagct tgtctcgttt        60
     attaccctgt gtgtcattgc ggccatggcc atggtgctgc ttggcggggt gttcagcttt       120
     cgtgagctgg gcatggagat gcaacagaag aaggtcaact cgctggtcga gatcatcgac       180
     aagcagctgg aggtggccga cgatcatcag gatctcaccc gctggctgcc gaccctgctg       240
     cgctcggccc acgtggtgga gctggagatc cgccaggaca agcagcggat ctactggttt       300
     cgtgacgtac agcagccgac cgacgagagc ttgctgatcc cctatcacca acccatgccc       360
     catcagccgg gcatgcaggc cgacttcaag ctggagcggc cgttcaagga gttcgagtac       420
     tccatcaagg cgatgtccgg catctccctc ggcgtcttca tcgtggtgtt cggcctctgg       480
     tactccattc gctggctgcg gttgcagttg cggggggccg agctgctggc cgagcgcgcc       540
     cagctgatcc tcgacaacaa gctcaccaag ctggcccatg atccggccga cgagtggccg       600
     cagccggcca gccaggccct cgactatctg ctggccgagc tggcggatgc ccgcaaggag       660
     cgcagccgct tcgacaactt catccgcagc aacgccttcg tcgacaagat gaccggcatc       720
     ggcaaccggc tgttcttcga caaccggctg gagagcgcca tcatggaggc gagcgtgatg       780
     agcggcggcg tgctgctgat cgagctggcc gggctggagg agctggatcc cgagctgaac       840
     ggccgccaga gccaggatct gctgatggag gcgagcgcct ccatcgccgc cttcgtgcgc       900
     aagcacaacg gcgccctgca ggcccgttat gccggccagg tgtttgcggt gctgctgccc       960
     aacatgtcgg aaagcgagat ggtggatggc gccggccagc tgcacaagag cctgcagcgg      1020
     ctgcactggc ccgaggcggt caatccagac accgccgtct atctcggcgc ggtctgctat      1080
     caggccgagg attccctgct aaaagtgcag gaggaggcgg agctggcgct caagagcgcg      1140
     cggctgcagg gccacaccgg ctggttcctc tacgagaaac agctggacga ggagcagagc      1200
     agcaagggta cggtgcgctg gcgcaccctg atcggccggc gcatcgagga gcatggcatc      1260
     gacttctacg tgcagccggt gcagcaggag cgggatcagg tggtattgca gcaggatctg      1320
     ctgatccgga tccacgacga gcaggggcgg gagctgcagg ccggcgtctt catgccgatg      1380
     gcggagaagg cggggctgtt gctgccgctg gatcggctgg tggcggaaca gaccctcggc      1440
     ctgctgcgcc agcgctccga acagagctgc cccatcagcc tgaccctctg cgcccagagc      1500
     ctgctgcacc gggagtttca gcgctggttg ttcttcgatc tgttccagct gccgcgcagc      1560
     accaacgagc gcttgatcct gcaactctcc gaggctcagg tcacccgcca ctatgaggcg      1620
     ctcaagcggc cgctgcgggc gctgcgcatg ctgggctgcc agctggccat cgatcacgcc      1680
     ggccaggatg tggtgagcac ccagtacatc aaggagttcg agatcaactt cctcaagctg      1740
     caccccagcc tggtgcgcga gatccatacc cgccaggtca accagatggc ggtgcgcagc      1800
     ctggtggggg gctgtgccaa cacccgcacc cgggtcatcg ccgtgggggt ggagagcggc      1860
     gacgagtgga agatgctgcg ccacctcggg gtgcacgccg ggcagggccc ctggttcgcc      1920
     gagccggaac ggctggtgct ggaaccggcc ggcgcctga                             1959
//

If you have problems or comments...

PBIL Back to PBIL home page