(data stored in ACNUC7421 zone)

EMBL: CP000462.PE363

CP000462.PE363       Location/Qualifiers
FT   CDS_pept        405890..406483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0387"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37696"
FT                   /db_xref="GOA:A0KF94"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF94"
FT                   /protein_id="ABK37696.1"
FT                   /translation="MKRQINLYGAEFRPRRQWASLNQMALVWGGSVLLLLCAAGVIAWQ
FT                   QHAVERELVQVRAALEIKRGEAQRLDAELARHQADGLLQQQLATKQEELTAKQGLMRQL
FT                   GSLALQKSQGYAGLMADLSRIRDPQLSLQRIEIADGYVNLSGFAGRSQDVPAWVNRFKQ
FT                   TPSLVGKQFGELTLSRDKEGRLAFQLSGIEREKP"
     atgaaacgcc agatcaatct ctacggcgcc gagtttcggc ccagacgaca gtgggccagc        60
     ctcaaccaga tggcgctggt atggggcggc agcgtgctgt tgctgctgtg cgccgccggc       120
     gtcatcgcct ggcagcagca cgctgtcgag cgcgagctgg tacaggtgcg ggcggcgctg       180
     gagatcaagc gtggcgaggc gcagcggctg gatgccgagc tggcccgtca ccaggccgat       240
     ggcctgctgc aacagcagct tgccaccaag caggaggagc tgaccgccaa gcagggcctg       300
     atgcggcagc tgggcagcct ggcgctgcaa aaatcccagg gctatgccgg gctgatggcc       360
     gatctctccc gcatccgcga tccgcagctc tccttgcagc ggatcgagat cgccgacggc       420
     tacgtcaacc tgtccggctt cgccgggcgc agccaggatg tgccggcctg ggtcaatcgt       480
     ttcaagcaga ctccgtcgct ggtgggcaag cagtttggtg agctgacgtt aagccgtgac       540
     aaggagggcc ggctggcctt ccagctcagc ggcatcgagc gggagaagcc ctga             594
//

If you have problems or comments...

PBIL Back to PBIL home page