(data stored in ACNUC7421 zone)

EMBL: CP000462.PE364

CP000462.PE364       Location/Qualifiers
FT   CDS_pept        406483..407130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0388"
FT                   /product="msha biogenesis protein mshj"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37309"
FT                   /db_xref="GOA:A0KF95"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF95"
FT                   /protein_id="ABK37309.1"
FT                   /translation="MSLKEQWQAWADKIAALSQRERVLILLTGVVVVGAVAIYGWLDGA
FT                   AVRLEQERLALSTAQRDLEIMDLENQGKQAKLARDPDLHVRTQLAQLDGELGKLDAELK
FT                   AQTVDLIQAHEMPAVLEALLSRSANLHMVALTSLTPEPLMAGEQRINLFKHGIRLKLEG
FT                   GYFDVYQYLKALEGLPRHFYWKQFDYQVQEYPKAVVEMEIYTLSTSKEFIRG"
     atgagcctga aagagcagtg gcaggcctgg gccgacaaga tcgccgccct tagccagcgc        60
     gagcgagtac tgatcctgct gaccggggtg gtcgtggttg gcgccgttgc catctatggc       120
     tggctggatg gggccgcggt gcggctggag caggagcggc tggcgctgag cactgctcag       180
     cgggatctgg agatcatgga tctcgagaac cagggcaagc aggccaaact ggcgcgggat       240
     ccggatctgc acgtgcgtac ccagctggca cagctggatg gcgagctggg taagctggac       300
     gccgagctga aggcccagac ggtggatctg atccaggccc acgagatgcc ggccgtgctg       360
     gaggccctgc tgtcgcgctc cgccaatctg cacatggtgg cactcacttc gctgacgccg       420
     gagccgctga tggcgggcga gcagcgcatc aacctgttca agcacggcat ccggctcaag       480
     ctggaaggcg gctatttcga tgtgtatcag tatctcaagg cgctggaggg gctgccgcgc       540
     cacttctact ggaaacagtt tgactaccag gtgcaggagt atcccaaggc ggtggtggag       600
     atggagatct acaccctcag caccagcaag gagtttatcc gtggctag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page