(data stored in ACNUC7421 zone)

EMBL: CP000462.PE366

CP000462.PE366       Location/Qualifiers
FT   CDS_pept        409271..410161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0390"
FT                   /product="general secretion pathway protein A"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36249"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF97"
FT                   /protein_id="ABK36249.1"
FT                   /translation="MYLNHFGLQEAPFGLTPNTGFYYGLPPHEEALQVLNWALAQGEGF
FT                   IKVTGEVGTGKTLLCRKLLSELGSEERPVRLAWLPNPHLNPAELRIALALELGLAVRDQ
FT                   SELDLTDRIHRHLIALHQQGSRVVVLIDEAQALPDETLEAIRLFGNLETESSKLLQIVL
FT                   FGQPELDARLAKPYLRQLRQRIGFSYCLRPLRFDETRAYLEHRLQISGYRGAPLFGGRA
FT                   LRQLWRASRGIPRLINILAQKCLMLAYGQGARQIDSRLVRLAVRDTDDARRFVPRRWWP
FT                   LVLLLGCALAYGVWQ"
     atgtacctga accacttcgg tttgcaggag gctcccttcg gcctcacccc caacaccggt        60
     ttctattacg ggctgccccc gcacgaggag gcgctgcagg tactcaactg ggcgctggcg       120
     cagggggagg gcttcatcaa ggtgaccggc gaggtcggca caggcaagac cctgctctgc       180
     cgcaagctgc tgagcgaact gggctccgag gagcggccgg tgcgtctggc ctggttgccc       240
     aacccccatc tcaacccggc cgagctgcgc atcgccctgg cgctggagct gggactggcg       300
     gtgcgggatc agagcgagct ggatctgacc gatcgcatcc atcgccacct cattgccttg       360
     catcagcagg ggagccgggt ggtggtgctg atcgacgagg cgcaggcgct gccggacgag       420
     acgctggagg cgatccggct gtttggcaac ctggagaccg aatcgagcaa gctgctgcag       480
     atcgtgctgt tcggacagcc cgagctggat gccaggctgg ccaagcccta tctgcgccag       540
     ctgcgccagc ggatcggttt ctcctactgc ctgcggccgc tgcgtttcga tgaaacccgg       600
     gcctacctgg agcacagatt gcagatttcc ggttatcgcg gggccccgct gtttggcggc       660
     cgggcgctgc gccagctgtg gcgtgcctcg cgcggtattc cgcgactcat caacatactg       720
     gcgcagaagt gcctgatgct ggcctatggc cagggggcgc gccagatcga tagccggctg       780
     gtgcggctgg ccgtacgcga caccgacgat gcccgccgct tcgtgccgcg gcgctggtgg       840
     ccactcgtac tgctgctggg ctgcgccctc gcttatggag tctggcaatg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page