(data stored in ACNUC7421 zone)

EMBL: CP000462.PE368

CP000462.PE368       Location/Qualifiers
FT   CDS_pept        411288..412997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0392"
FT                   /product="type IV pilin"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM PF05157"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39289"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF99"
FT                   /protein_id="ABK39289.1"
FT                   /translation="MAQPRLKMRLGDLLVQEQIISDDQLQLALQQQRQTGRKLGTTLID
FT                   LGFISEVQLLQFLARQLDVPFFDLNNLTIDASAVPLLPEVQARRYRALAVNLTDNKVTV
FT                   AMSDPADLSALDAIAALLRPREMGLAVAREGQLLEYFDRLYRRTREIESFAEQLHEEYQ
FT                   DAGFELGSSNLGAGDEGEATVAKLLRSLFEDAVQVGASDIHIEPDEKVLRIRQRIDGIL
FT                   HENILSEVRIAQALVLRLKLVAGLDISEKRLPQDGRFNMKVRGRDVDVRMSTMPVQYGE
FT                   SVVMRLLDQSSGILSLTETGMPPEILTRFRRQLKRPHGMILVTGPTGSGKTTTLYGALS
FT                   ELNQASQKIITVEDPVEYRLPRVNQVQVNPKIGLTFSHVLRSTLRQDPDILLVGEMRDN
FT                   ETVEIGLRGAITGHLVLTTLHTNDAVTSALRLIDMGAPGYLVASALRAVVAQRLVRRVC
FT                   EHCVEEKAPDEGQATWLTVLSGEAPGQHVYHKGRGCQSCNFTGYAGRIGVYELLELDQP
FT                   MMDSLRRNDAEGFAKAARQHPHYRPLALTALDYARQGITSVDEVLRLAEDLG"
     atggcacaac ccagactgaa aatgcgcctc ggcgacctgc tggtacaaga gcagatcatc        60
     tcggatgatc agctgcagct cgccctgcag cagcagcgtc agaccggccg caagctgggc       120
     accaccctga tcgatctcgg cttcatcagc gaggtgcaac tgctgcagtt tctcgcccgc       180
     cagctggatg tgcccttctt cgatctcaac aacctcacca tagatgcgtc ggcggtgccg       240
     ctgctgccgg aagtgcaggc gcgccgctat cgtgcgctgg cggtcaacct caccgacaac       300
     aaggtgacgg tggccatgtc ggatccggcc gacttgagcg ccctcgacgc catcgcggcg       360
     ctgctgcgcc cgcgggagat ggggctggcg gtggcgcggg aaggccagct gctggagtat       420
     ttcgaccgcc tctatcgtcg cacccgcgaa atagagagct tcgccgaaca gctacatgag       480
     gagtatcagg acgccggctt cgagctgggt tccagcaatc tgggggcggg tgacgagggg       540
     gaggcgacgg tggccaagct gctgcgctcc ctgttcgagg atgcggtgca ggtgggggcc       600
     tccgatattc acatcgagcc ggacgagaag gtgctgcgca ttcgccagcg catcgacggc       660
     atcctgcacg agaacatcct gagcgaggtg cgtatcgccc aggcgctggt actgcgcctc       720
     aagctggtgg ccggcctcga tatctccgag aagcggctgc cgcaggatgg ccgcttcaac       780
     atgaaggtgc gcggccgcga cgtggatgtg cggatgtcga ccatgccggt gcagtacggt       840
     gaatccgtgg tgatgcggct gctggaccaa tcctccggca tcctgtcgct gaccgagacc       900
     ggcatgccgc cggagatcct gacccgcttc cggcgccagc tcaagcgacc ccacggcatg       960
     atcctggtga cgggcccaac cggtagcggc aagaccacta ccctctacgg cgccctctcc      1020
     gagctcaacc aggccagcca gaagatcatc acggtggaag atccggtgga atatcggctg      1080
     cccagggtca atcaggttca ggtcaatccc aagatcgggc tgaccttctc ccacgtgctg      1140
     cgctccaccc tgcgccagga ccccgacatc ctgctggtgg gcgagatgcg ggacaacgaa      1200
     acggtggaga tcggcctgcg cggcgccatc acaggtcacc tggtgctgac cacgctgcac      1260
     accaacgatg cggtgaccag cgccctgcgc ctcatcgaca tgggggctcc cggctatctg      1320
     gtggcgagcg cgctgcgggc ggtggtggct cagcggctgg tgcggcgggt gtgcgagcac      1380
     tgcgtcgagg agaaggcgcc ggatgaaggc caggccactt ggctgaccgt gctctccggc      1440
     gaagcgccgg gccagcacgt ctatcacaag gggcgcggct gccagagctg caacttcacc      1500
     ggctatgccg gccggatcgg ggtgtacgag ctgctggagc tggatcagcc catgatggac      1560
     tccctgcgcc gcaacgacgc cgaagggttt gccaaggcgg cccgccagca cccgcactac      1620
     cggccgctgg cgctgaccgc gctcgattac gcccgccagg ggatcacctc ggtggacgag      1680
     gtgctgcggc tggcggagga cctggggtaa                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page