(data stored in ACNUC7421 zone)

EMBL: CP000462.PE369

CP000462.PE369       Location/Qualifiers
FT   CDS_pept        413051..414271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0393"
FT                   /product="GspF family protein"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38845"
FT                   /db_xref="GOA:A0KFA0"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA0"
FT                   /protein_id="ABK38845.1"
FT                   /translation="MSSFAYKGRDSQGNAVSGVVDAANEMAAAEQLMRRGVMPTELKPG
FT                   KAKAAALDWSLLLERGVRLDELVVFSRQMYALTRAGIPILRAIAGLEESAHSKPLKRAL
FT                   HALGEDLGNGRPLSSSMQAHPRVFSSLFVAIIHVGENTGQLEEAFLQLANYFELELETR
FT                   KRIKTAMRYPSFVLIAIGIAMVILNIMVIPVFAGMFAKFGVELPLATRILLATSHFFVH
FT                   YWWVMLGVLLAMVFGWRRWVSTVKGKLTWHRWQLKLPIVGTIIERSLLARFARSFSMML
FT                   KAGVPLNTALSLVADAVDNAWMAGRIRDMRAGIERGESLLRTAGSSGLFTPLVMQMIAV
FT                   GEETGQVDDLLHEAAEYYEREVDYDLKSLTARIEPILIGIVAVMVLILALGIFTPMWDM
FT                   MRAVRGK"
     atgagcagct tcgcctacaa ggggcgcgac agccagggca atgccgtcag cggggtggtg        60
     gacgcggcca acgagatggc tgcggccgag cagctaatgc gccgcggcgt gatgccgacc       120
     gagttgaaac ccggcaaggc gaaggcggcc gccctcgact ggtcgctctt gctggagcgg       180
     ggcgtgcggc tggacgagct ggtggtgttc agccgccaga tgtatgccct gacccgggcc       240
     ggcatcccca tcctgcgcgc catcgccggg ctggaggaga gcgcccacag caagccgctc       300
     aagcgggcgc tgcacgcgct gggagaggat ctgggcaacg gtcggccgct gtcgagctcg       360
     atgcaggccc accccagggt gttcagcagc ctgttcgtgg ccatcatcca cgtgggggag       420
     aacacgggtc agctggaaga ggcgttcttg cagcttgcca actatttcga gctggagctg       480
     gaaacccgca agcggatcaa gaccgccatg cgctacccca gcttcgtgct gattgccatc       540
     ggcatcgcca tggtgatcct caacatcatg gtgatcccgg tctttgccgg catgttcgcc       600
     aaatttggcg tcgagctgcc gctggcgacc cggatcctgc tcgccacctc ccacttcttc       660
     gtgcactact ggtgggtgat gctcggcgtg ttgctggcca tggtgtttgg ctggcggcgc       720
     tgggtgagca cggtcaaggg caagctgacc tggcacagat ggcagctcaa gttgccgatc       780
     gtcggcacca tcatagagcg ctccctgctg gcccgctttg cccgcagctt ctccatgatg       840
     ctcaaggccg gggtgccgct caacacggcg ctgagcctgg tggccgatgc ggtggacaac       900
     gcctggatgg cgggccggat ccgcgacatg cgggccggca tcgagcgggg tgagagtctg       960
     ctgcgcaccg ccggcagcag cggcctgttc accccgctgg tgatgcagat gatcgcggtg      1020
     ggggaagaga ccggccaggt cgatgatctg ctgcacgagg cagccgagta ttacgagcgg      1080
     gaggtggact atgacctcaa gagtctcacc gcccggatcg agccgatcct gatcgggatc      1140
     gtggcggtca tggtattgat cctggcgctg ggtatcttca cgccgatgtg ggacatgatg      1200
     cgggccgtac gcggcaagta a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page