(data stored in ACNUC7421 zone)

EMBL: CP000462.PE371

CP000462.PE371       Location/Qualifiers
FT   CDS_pept        414987..415658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0395"
FT                   /product="msha pilin protein mshb"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37751"
FT                   /db_xref="GOA:A0KFA2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA2"
FT                   /protein_id="ABK37751.1"
FT                   /translation="MTTTRLVPRYSGVVSPHRAAGFSLIELVIVIVILGILAVTALPRF
FT                   LDVTDEAKKASVEGVSGGFATGVSLVRAQWEAEGRAKQDSLNTVLYDGSRFYLTTPTDT
FT                   QVSNGELSPGYPMDTSAGGGIDVDPANLTAPRCLKIWEGLLQNPPKATASFSEVRGSGN
FT                   DLKYYVSVTNNGLDSVCRYYLVNSLSKGSDGKYQDPQGSTDAFMSFSYRPASGQVTTNI
FT                   N"
     atgacaacaa cgcgactggt accaagatat tccggtgtgg tgagtcccca tcgggcagcg        60
     ggtttctcgt tgatcgagct ggtgatcgtc atcgtcatcc tggggatcct ggcggtcacc       120
     gccttgcccc gctttctcga tgtcacggac gaagccaaga aagccagtgt ggagggggtc       180
     tccggcgggt ttgccaccgg cgtgtcgctg gtacgggctc aatgggaggc cgaagggcgc       240
     gccaagcagg acagcctcaa taccgtgctc tatgacggtt cacgttttta tctgaccacg       300
     ccgaccgaca cccaggtcag caacggcgag ctctcccccg gttatcccat ggatacctcg       360
     gccggtggcg gcatcgacgt ggatccggcc aacctgacgg ccccgcgctg tctcaagatt       420
     tgggagggtc tgctgcagaa cccacccaag gctaccgcca gcttcagcga ggtgcgtggt       480
     agcggcaatg acctgaaata ctatgtcagt gtgaccaata acggcctgga ctcggtctgc       540
     cgctactatc tggtcaatag tttgagtaag ggtagtgatg gcaagtatca ggatccgcaa       600
     ggcagtactg atgcattcat gagtttcagt taccgtccgg cttccggtca ggtgaccacc       660
     aatatcaatt ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page