(data stored in ACNUC7421 zone)

EMBL: CP000462.PE374

CP000462.PE374       Location/Qualifiers
FT   CDS_pept        417199..418020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0398"
FT                   /product="putative msha biogenesis protein msho"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36151"
FT                   /db_xref="GOA:A0KFA5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFA5"
FT                   /protein_id="ABK36151.1"
FT                   /translation="MRTASGFTLIELVMVILLLGIMATFASQFIGIGTQIYGDASSREQ
FT                   LMSDARFAMERLNREVRDALPGSERIEALDGSWDDSGPCLRFWPISTSSRYLALNRAQS
FT                   GSTSTLELVMAIPASAANPLNQDANAVKVGDLMVVFPMPTSAAGSLVNGCEYGRCVARV
FT                   TEVLAPVSGAQTVRYISGETLAGISPGSRVYFANQQVRYCVEGSTMTRSSAAIDAPVAA
FT                   GVLMAESLRAGNFYREVSAFNAEGAFGVRLVFERQGEAVTFNHKLGVFNVP"
     atgcggacgg cgagcggttt taccctgatc gaactggtga tggtgatcct gctgctgggg        60
     atcatggcca ccttcgccag ccagttcatc ggcatcggca cccagatcta cggcgatgcc       120
     agcagccgcg aacagctgat gagtgatgcc cgcttcgcca tggagcggct caaccgcgag       180
     gtgcgcgatg cgttgccggg ctccgagcgg attgaagccc tggatggcag ctgggatgac       240
     agcggtccct gcctgcgttt ctggcccatc agcacctcca gccgctatct tgcgctcaac       300
     cgggcccagt ccggcagcac atccaccctg gaactggtga tggcaatccc cgcctctgcg       360
     gccaatccac tcaaccagga tgccaatgcg gtcaaggtcg gggatctgat ggtggtcttc       420
     ccgatgccga cgtcagcggc cggctcactg gtcaatggct gtgaatatgg ccgctgtgtc       480
     gccagggtca ccgaggtgct ggcgccggta tcgggggcgc agaccgttcg ctatatcagt       540
     ggcgaaaccc tggccgggat ctcgcccggc agccgggttt attttgccaa tcagcaggta       600
     cgctactgcg tggaaggcag cacgatgacg cgatccagcg ccgcgatcga tgcccctgtt       660
     gcagcgggtg tgctgatggc tgagtcgctt cgtgccggca acttctatcg ggaggtctcg       720
     gccttcaatg ccgaaggagc gtttggcgtg cggctggtgt tcgaacgcca gggcgaagcg       780
     gtcaccttca accacaagct gggggtcttc aatgttccct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page