(data stored in ACNUC7421 zone)

EMBL: CP000462.PE380

CP000462.PE380       Location/Qualifiers
FT   CDS_pept        425670..427139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0404"
FT                   /product="ribonuclease G"
FT                   /EC_number="3.1.4.-"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM TIGR00757"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37871"
FT                   /db_xref="GOA:A0KFB1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB1"
FT                   /protein_id="ABK37871.1"
FT                   /translation="MSVELLVNVTPSETRVALVENGLLQEVHVERQAKRGIVGNIYKGK
FT                   ISRVLPGMQAAFVDIGMDKAAFLHASDIVPHTECVAVKEKEQFQAGNIAELVRQGQDIM
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVFMPGSAHVGVSQRIESEAERERLKRTVAGYVD
FT                   ELGGYIIRTAAEGVGEQELEQDAAFLKRLWRKILERKQKYPPCKILYEDPSLAFRVVRD
FT                   FVGAELDKIRVDSRQSFDQLKRFTEEYVPELANKLEYYSGESPIFDLYDVENEIQRALE
FT                   RKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLEETIFNTNVEATAAIARHLRLRNL
FT                   GGIIIIDFIDMQSEDHRRRVLHSLEQALSKDRAKTNVNGFSQLGLVEMTRKRTRESLEH
FT                   VLCSECPECKGRGRVKTVESVCFEILREIIRVNRAYDADQFTVYAAPAVADYLRGEESH
FT                   SLAELEVFIGKQVRVVSEPLCGQEQFDVVMM"
     atgtcggtag aactgctggt aaacgtcacc ccctccgaaa cccgggttgc cctggtcgag        60
     aacggtctgc tgcaggaagt gcacgtggag cgtcaggcca agcgcggcat cgtgggcaac       120
     atctacaaag gcaagatcag ccgggtgctg cccggcatgc aggcggcttt cgtcgatatc       180
     ggcatggaca aggcggcctt cctgcacgcc tccgacatag tgccgcacac cgagtgcgtg       240
     gcggtgaagg agaaagagca gttccaggct ggcaacatcg ccgagctggt gcgccagggg       300
     caggacatca tggtgcaggt ggtgaaagat ccgctgggca ccaagggcgc ccgccttacc       360
     accgatatca ccctgccgtc ccgctatctg gtgttcatgc cgggcagtgc ccacgtcggc       420
     gtctcccagc gcatcgagtc cgaggcggag cgcgagcgcc tcaagcgcac cgtggccggc       480
     tatgtggacg agctgggtgg ctacatcatc cgcaccgctg ccgaaggggt gggtgagcag       540
     gagctggagc aggatgccgc tttcttgaag cgcctgtggc gcaagatcct ggagcgcaag       600
     cagaagtacc ccccctgcaa gatcctctac gaggatccca gcctggcctt tcgggtggta       660
     cgcgacttcg tcggggctga gctcgacaag atccgggtcg actcgcgcca gagcttcgat       720
     cagctcaagc gcttcaccga ggagtacgtg cctgagctgg ccaacaagct ggagtactac       780
     tccggcgagt cgccgatctt cgatctctac gacgtggaga acgagatcca gcgcgcgctg       840
     gagcgcaagg tagagctcaa atccggcggc tacctcatca tcgaccagac cgaagccatg       900
     accacggtgg acatcaacac cggggccttc gtcggccatc gtaacctgga agagaccatc       960
     ttcaacacca acgtcgaggc gacggcggcc atcgcccgcc acctgcgcct gcgcaacctc      1020
     ggcggcatca tcatcatcga cttcatcgac atgcagtcgg aggatcaccg ccggcgggtg      1080
     ctgcacagcc tggagcaggc gctgtcgaag gaccgcgcca agaccaacgt caacggcttc      1140
     tcccagctcg gcctggtgga gatgacccgc aagcgcaccc gcgagagcct ggagcacgtg      1200
     ctctgctccg agtgccccga gtgcaagggg cgcggtcgag tcaagacggt ggagtcggtc      1260
     tgcttcgaga tcctgcggga gatcatccgg gtcaaccggg cttacgacgc ggatcagttc      1320
     accgtctacg ccgcaccggc ggtggccgac tacctgcggg gcgaggagtc tcacagtctg      1380
     gccgaactgg aagtgttcat cggcaagcag gtcagggtgg tgagcgagcc cctctgcggg      1440
     caggagcagt tcgacgtggt gatgatgtaa                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page