(data stored in ACNUC7421 zone)

EMBL: CP000462.PE381

CP000462.PE381       Location/Qualifiers
FT   CDS_pept        427170..431039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02099"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38887"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB2"
FT                   /protein_id="ABK38887.1"
FT                   /translation="MALGVFFVLLAILVSLVRFGGPLLNQHRQALLNTLLADSKLEASV
FT                   DRIGLDWTQLGPALELQQLVIAPNSGRFALRLGKVWAHLDFWRSLNELKPVFGQLILSD
FT                   GDIALDLGQPAEPETGNGSDQQQALLRFLLTQLSTFDIHDTRLSLTTALGEVRALDIAQ
FT                   LRWQNRGKRHQGVGKAYLINGVGESTLDLIVDVDAPQVRLDRLKGQLYLGARQLDISPM
FT                   LARTHSGEPKVSGQLDFQLWSEFKAGQLGDSLLAFGDNYLIWQDEKQGDLHRLGLQGGK
FT                   IQLRRDGKEWQFASHDVTFKLDGKPWLHSRLQLERVGDRIQGYVPAIDLDQIANLSQLV
FT                   SGIYPELTETLKRTRPTGKIQDLILQADAGWQGLSVSGQLSHIRVNAWHDVPGVRDLNG
FT                   EFWLTPTGGSARLQLANDAIDPARHFKEPIPIDRFSARLDWWQVPQGWVLYGQDLVLDN
FT                   PDLSLASRFRLDLFEHPFLALTGRIDVKNAANADRYYPLQVMDKSLVDYLSGAIKGGKA
FT                   KGADLLWYGEFRDFPYRKGEGIFQVAVPLQQASYEFFPGWQPLTDLQIDLLFQNASLDM
FT                   NSRATQLGKASSDSVHAWIPDLYPGAHLYVDAKVEGEGKAISDYLQDSPLGGSVGQALR
FT                   EVEIRGPMKGSVKLDIPLDGESEVKASGDALFSNNKVRVTSLDLPLEQVQGRLEYDNEQ
FT                   TRFSNLKASLWNQPLTLDYQGRQQPNRYQVDLKFKGQWDSRRQRQDIPALDILKGRGNW
FT                   AGSLGLTLPGDQPFSFQLALDSNLQGMGLDLPAPLAKAAGSRLPLKVTARGRDGSADIR
FT                   AVLGADVDMQSRLVYGDGVPYLSRVRVDVGQPGARVLRDRPMLLAINQQQADVAGWLAR
FT                   LKQWLPASTAPSGNAVVGPSFLPQEWWVDGRLARADIGSANLKAVHFTVGPVNQATEVM
FT                   IDSPDVMGVVRLPVSERQPIDAKFARIHWSGKSSDLSPDPDARQDRAIMDAIPWLTFSC
FT                   VDCRFGELPLGEVKGELIPGADKLSLKGLEMRLAGSQLNGSAEWLAGADGMQTRARAHI
FT                   SSNNSELLLKRLGYTSPIGDAPGKMALDLSWRDVPYRPNVPTLSGTADYQLEGGTLREV
FT                   NDKGARLLSLLSLDSLLRKLRLDFRDVFDKGFYFESMSASAKIKQGVVDNRDFYMKGAA
FT                   GNLRGEGIADLVRWRLDYELSFSPNLGGTLPVVAAFSLTPITGLYVLALSKLLEPVVDV
FT                   VTRIDFRVSGPLDDPKLIEAGRDRARIKLNQQQKEAVDAVAPNLPTQEVTPFLLTPKHA
FT                   GPAQR"
     ttggccctcg gggtcttctt cgtgctgctg gccatcctgg tcagcctggt gcgctttggc        60
     ggccccttgc tcaatcagca ccggcaggcg ctgctcaata ccctgctggc cgacagcaag       120
     ctggaggcca gcgtcgatcg catcgggctg gactggactc agctcggccc ggccctcgaa       180
     ctgcagcaac tggtgatcgc gccgaattcg ggtcgcttcg ccctgcgtct tggcaaggtg       240
     tgggcccacc tcgacttctg gcgctccctc aacgaactca agccggtgtt tggccagttg       300
     atcctgagcg atggcgacat cgcgctggat ctaggccagc ccgcggagcc ggaaaccggc       360
     aacggcagcg accagcagca ggccctgctg cgctttctgc tgactcagct ctccaccttc       420
     gatattcacg acacccgtct cagcctcacc acggcgctgg gggaggtgcg cgccctcgac       480
     atcgcccagc tgcgctggca gaaccgcggc aaacgccatc agggggtcgg taaggcctat       540
     ctcatcaacg gggtgggcga gagtaccctc gacctcatcg tcgacgtgga tgccccccag       600
     gtgcggctcg atcgactcaa gggccagctc tatctggggg cccgccagct cgacatcagc       660
     cccatgctgg cccgcaccca ctcaggggag cccaaggtga gcggccagct cgactttcag       720
     ctctggagcg agttcaaggc cggccagctg ggggattcgc tgctggcgtt tggcgacaac       780
     tatctgatct ggcaggatga aaaacagggt gacctgcacc ggctcgggct gcaggggggc       840
     aagatccagc tgcgccggga cggcaaggag tggcagtttg ccagccacga cgtcaccttc       900
     aagctcgacg gcaagccctg gctgcacagc cggctgcagc tcgagcgggt cggcgatcgc       960
     atccagggtt atgtgccggc catcgatctg gaccagatcg ccaacctgag ccagctggtg      1020
     tcggggatct atcccgagct gaccgagacc ctcaagcgca cccgcccgac cggcaagatc      1080
     caggatctga tcctgcaggc ggatgccggc tggcaggggc tctccgtcag cggccagctg      1140
     tcccacatcc gggtcaacgc ctggcacgat gtgcccggcg tgcgcgacct caacggcgag      1200
     ttctggctca ccccgaccgg cggcagcgcc cggctgcaac tggcaaacga tgccatagat      1260
     ccggcccgcc acttcaagga gccgatcccc atcgatcgtt tctcggcgcg gctcgactgg      1320
     tggcaggtgc cgcagggctg ggtgctctat ggccaggatc tggtgctgga caacccggac      1380
     ttgagcctag ccagccgttt tcggctcgat ctgttcgagc accccttcct cgccctgacc      1440
     ggtcgcatcg acgtcaagaa tgcggccaac gccgatcgtt actatccgct gcaggtgatg      1500
     gacaagagcc tggtggatta cctgagcggg gccatcaagg ggggcaaggc caagggggct      1560
     gacctgctct ggtatggcga gttccgtgac ttcccctacc gcaagggcga gggcatcttc      1620
     caggtggcgg tgccgctgca gcaggcctcc tacgaattct tccccggttg gcaaccgctt      1680
     accgacctgc agatcgatct gttgttccag aacgccagcc tcgacatgaa cagccgcgcc      1740
     acccagctcg gcaaggccag ctccgactcg gtgcacgcct ggatcccgga cctctatccg      1800
     ggtgctcacc tctacgtgga cgccaaggtt gagggcgagg gcaaggccat cagcgactac      1860
     ttgcaggact cgccgctcgg cggctcggtc ggtcaggcgc tgcgggaggt ggagatccgc      1920
     ggccccatga agggctcggt gaagctggat attccgctgg atggcgagag cgaggtcaag      1980
     gccagcggcg acgccctgtt cagcaacaac aaggtgcggg tgaccagcct ggatctgccg      2040
     ctggagcagg tgcaggggcg gctcgagtat gacaacgagc agacccgctt cagcaacctc      2100
     aaggcgagcc tgtggaacca gccgctcacc ctcgactatc aggggcgcca gcagcccaat      2160
     cgctatcagg tcgatctcaa gttcaagggg cagtgggaca gccgccgcca gcgtcaggac      2220
     atcccggcgc tggacatcct caaggggcgc ggcaactggg ccggcagcct ggggctgacc      2280
     ctgccgggcg atcagccgtt cagcttccag ctggcgctcg actccaacct gcagggcatg      2340
     gggctggatc tgcccgcgcc gctcgccaag gcggccggca gccggctgcc gctcaaggtg      2400
     accgcgcgtg gtcgcgatgg cagtgctgac atccgcgccg tgctcggggc cgacgtggat      2460
     atgcagagcc ggctggtgta cggcgacggt gtgccctacc tcagccgggt gcgggtggac      2520
     gtggggcagc ccggcgcccg ggtgctgcgc gaccggccca tgctgctcgc catcaaccag      2580
     cagcaggccg atgtggctgg ctggctggcc cgtctcaagc agtggctgcc ggccagcacg      2640
     gcgccgagcg gcaatgcggt ggtgggcccc tccttcttgc cgcaggagtg gtgggtggac      2700
     ggccgtctgg cccgcgccga catcggcagc gccaacctca aggcggtgca cttcaccgtg      2760
     gggccggtca atcaggccac cgaggtgatg atcgacagcc cggacgtgat gggggtggtg      2820
     cgcctgccgg tatccgagcg tcagcccatc gacgccaaat ttgcccgcat ccactggtcc      2880
     ggcaagagtt cggatctgag cccggacccc gatgccagac aggacagagc catcatggat      2940
     gccatcccct ggctcacctt cagctgcgtg gactgccgct tcggcgagtt gccgctgggg      3000
     gaggtgaagg gggagctgat cccgggggcc gacaagctga gcctcaaggg gctggagatg      3060
     cggctggcgg gcagccagct gaacggcagc gccgagtggc tggccggggc ggatggcatg      3120
     cagacccgcg cccgcgccca catcagcagc aacaacagcg agctgctgct caagcggctc      3180
     ggctacacct cgcccatcgg cgatgcgccc ggcaagatgg cgctggatct gagctggcgc      3240
     gacgtaccct atcggcccaa cgtgccgacc ctgagcggca ctgcagacta ccagctggaa      3300
     ggtggcaccc tgcgcgaggt caacgacaag ggggcgcgac tgctctccct gctcagcctg      3360
     gattcattgc tgcgcaagct gcgcctcgat tttcgcgacg tgttcgacaa gggcttctac      3420
     ttcgagtcca tgtcggcctc cgccaagatc aagcaggggg tggtggacaa ccgcgacttc      3480
     tacatgaagg gggcggccgg caacctgcgc ggcgagggta tcgccgatct ggtgcgctgg      3540
     cggctcgact acgagttgag cttctccccc aacctgggcg gcaccctgcc ggtggtggcg      3600
     gccttctcgc tgaccccgat caccgggctc tatgtgctgg cgctctccaa actgctggag      3660
     ccggtggtgg acgtggtcac ccgcatcgat ttccgggtct ccggcccgct cgacgatccc      3720
     aagctgatcg aggcgggacg ggatcgggcc cgcatcaagc tcaaccagca gcagaaggag      3780
     gcggttgacg cggtggcccc caacctgcca acgcaggagg tgaccccttt cctgctgacc      3840
     cccaagcacg cggggcccgc ccagcgctga                                       3870
//

If you have problems or comments...

PBIL Back to PBIL home page