(data stored in ACNUC7421 zone)

EMBL: CP000462.PE383

CP000462.PE383       Location/Qualifiers
FT   CDS_pept        431423..432229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0407"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39820"
FT                   /db_xref="GOA:A0KFB4"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB4"
FT                   /protein_id="ABK39820.1"
FT                   /translation="MWLAAIQLVSGRRWQDNREQIAAELALLPSERPLLVLLPENFALF
FT                   GERQGYLDGAEAIGAGPIQAQLAEWARDYGIWLVAGAMPTTIAGSDHIHTSTLVFDPSG
FT                   ERKGHYHKIHLFDVDVADNHGRYRESETFSPGEEPVLVDSPFGPLGLSICYDLRFPELY
FT                   RRLARAGARVLLVPAAFTAVTGEAHWEPLLRARAIENQCYLVAANQGGTHETGRQTWGH
FT                   SMVIDPWGRVLASLDSGRGTVLAPLDPGLVDELQRTMPVLGHARLL"
     atgtggttag ccgcaataca gctggtatcg ggccgtcgct ggcaggataa ccgggagcag        60
     atcgccgccg agctggccct gttgccgagt gagcggccac tgctggtgct gctgccggag       120
     aatttcgccc tgtttggcga gcggcagggc tatctggacg gggccgaggc aatcggtgca       180
     gggccgatcc aggcccagct ggccgaatgg gcccgtgatt acggcatctg gctggtggcg       240
     ggggccatgc cgaccaccat cgccggttcc gaccatatcc acaccagtac cctggtgttc       300
     gatcccagcg gtgagcgcaa gggccactac cacaagatcc acctgttcga tgtggacgtg       360
     gcggacaatc acggccgtta ccgggagtcg gaaaccttca gccccggtga ggagcctgtg       420
     ctggtggact ccccgtttgg tcccctcggc ctctcgatct gttatgatct gcgctttccc       480
     gagctgtacc gccggctggc ccgcgccggt gcccgcgtgc tgctggtgcc tgccgccttc       540
     accgccgtga ctggcgaggc gcactgggag ccgctgctgc gggcccgcgc catcgagaac       600
     cagtgttacc tggtggccgc caatcagggc ggcacccacg agacggggcg ccagacctgg       660
     ggtcacagca tggtgatcga cccctggggt cgggtgctgg ccagcctgga cagcgggcgc       720
     ggcaccgtgc tggcaccgct ggaccccggt cttgtcgacg aactgcaacg caccatgccg       780
     gtgctgggcc atgcccgtct gctatga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page