(data stored in ACNUC7421 zone)

EMBL: CP000462.PE387

CP000462.PE387       Location/Qualifiers
FT   CDS_pept        complement(435464..436537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0411"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39609"
FT                   /db_xref="GOA:A0KFB8"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFB8"
FT                   /protein_id="ABK39609.1"
FT                   /translation="MKQSMLALAIPALLAVGTAQAAVIYQADDGSNVDLYGRLGFNISD
FT                   KKSGNDQGDFDGRIGFTARQTVNEQVAVIGMAQYQVNAAEYANNVQKNSSDLTARYVWA
FT                   GLDGGQWGKLTGGRVSSGLIMFTDIGDVFAASDVSMARQASKVDSTAVQVFRQDGTLQY
FT                   QNTLGNLDLSLAYILGNGTSDLDYGYNGALRYTFDLGAAGKLAPVIAYQQSKAAQTGAS
FT                   KVDPNADEYRFSGIGTRYTLGPLMLGALYAKDQVSYRNGQADSEDKVWELTAVYDINQK
FT                   WAARAGYRHLDNDGGDGMSLRDTTLELQYKLTPRSSLYSAYVFRGGEDGLAGSTVTSFG
FT                   GSSNSEDFYHLGLRYEF"
     atgaaacagt ccatgcttgc cctggccatt cctgccctgc ttgccgtcgg tacggcgcag        60
     gccgccgtca tctatcaggc cgatgacggc tccaacgtcg atctctacgg tcgcctcggc       120
     ttcaacatct cggacaagaa gagcggcaac gatcagggcg acttcgacgg ccgcatcggc       180
     ttcaccgccc gccagaccgt caacgagcag gtggccgtga tcggcatggc ccagtaccag       240
     gtcaatgccg ccgaatacgc caacaacgtg cagaagaaca gcagcgatct caccgcccgt       300
     tacgtctggg ccgggctcga tggcggccag tggggcaagc tgaccggtgg ccgggtctcc       360
     tccgggctca tcatgttcac cgacatcggc gacgtgtttg ccgcctccga tgtctccatg       420
     gcgcgccagg ccagcaaggt ggactccacc gcggtacagg tgttccgtca ggacggcacc       480
     ctgcaatacc agaacaccct cggcaatctg gacttgtcgc tggcctacat cctcggcaac       540
     ggcacctcgg atctcgacta cggctacaac ggcgccctgc gctacacctt cgatctcgga       600
     gcggcgggca agctggcgcc agtcatcgcc taccagcaga gcaaggcggc ccagaccggt       660
     gccagcaagg tcgaccccaa cgccgacgag taccgcttca gcggtatcgg tacccgttac       720
     accctgggcc cgctgatgct gggcgccctc tatgccaagg atcaggtgag ctatcgcaac       780
     ggccaggcgg acagcgaaga caaagtgtgg gagctgaccg cggtctacga catcaaccag       840
     aagtgggccg cccgcgccgg ctaccgccac ctcgacaacg acggaggaga cggcatgagc       900
     ctgcgcgaca ccaccctgga gctgcagtac aagctcactc cgcgctcctc cctctacagc       960
     gcctacgtat tccggggcgg tgaagacggg ctggccggca gcacggtcac cagttttggc      1020
     ggcagcagca acagcgagga tttctaccac ctcggcctgc gctacgagtt ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page