(data stored in ACNUC7421 zone)

EMBL: CP000462.PE390

CP000462.PE390       Location/Qualifiers
FT   CDS_pept        complement(439353..439607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0414"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36984"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC1"
FT                   /protein_id="ABK36984.1"
FT                   /translation="MLGKFMDGHPLTSGDVQMEKMLTEIGSYSLFHEYLNVVGAASPAL
FT                   TRIKSRWEYKQSDRLVAQIRVDQQGNARFFIDARAISVN"
     gtgcttggta agtttatgga tggacaccca ctcacttcag gagatgtgca aatggaaaag        60
     atgctgaccg agattggaag ctacagcctg tttcatgaat atctgaacgt ggtcggtgcc       120
     gccagccccg ctctgacccg gatcaagagc cggtgggagt acaagcagag cgatcgtctg       180
     gttgcccaga tcagggtcga tcaacaaggc aacgcgcgct tcttcatcga cgcccgcgcc       240
     atttcggtca actga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page