(data stored in ACNUC7421 zone)

EMBL: CP000462.PE394

CP000462.PE394       Location/Qualifiers
FT   CDS_pept        complement(442800..444002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0417"
FT                   /product="regulatory components of sensory transduction
FT                   system"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39902"
FT                   /db_xref="GOA:A0KFC5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFC5"
FT                   /protein_id="ABK39902.1"
FT                   /translation="MPWHICNKSGPSGPICSTKSEATIMLNLLDPDTKPTLLVVDDTPE
FT                   NLSLLSALLSPHYRVKVAISGQRALEILSAGTRVDLILLDVVMPQMDGYQVMQALQEMP
FT                   QAREIPVIFLTAKVEESAEAHGLALGAVDYIHKPITPAIVLARVRNHLELKAARDLLHD
FT                   QNAFLEQEVERRTRENELIQNITIHSLASLAETRDNETGNHILRTQHYVRLLAETLCEH
FT                   PRFRAELTPKTIDLLFKSAPLHDIGKVGVPDRILLKPGKLDADEFAQMKHHSILGKEAI
FT                   VHAEEALGVEVEFLRLAKEIACYHHEKWDGTGYPYGLIGDEIPLSARLMALADVYDALI
FT                   SKRCYKAAMSHQEVVPIILAGRGNHFDPDITDAFARIHQQFHEIALRYNDDKGERESNR
FT                   D"
     atgccctggc acatctgcaa caagtccggg ccctcaggcc cgatctgttc aaccaagagt        60
     gaggccacca tcatgctcaa cttgctggat cccgatacca aacccaccct gctggtggtc       120
     gatgacacac cggagaacct ctccctgctc agcgccctgc tcagccccca ctaccgggtc       180
     aaggtcgcca tcagcggcca gcgggcgctg gagatcctct cggccggcac ccgggtggac       240
     ctgatcctgc tcgacgtggt gatgccccag atggatggct atcaggtgat gcaggcactg       300
     caggagatgc cgcaggcgcg ggagatcccg gtgatcttcc tgaccgccaa ggtggaggag       360
     agtgcggagg cacacggcct ggcgctgggg gctgtcgact acatccacaa accgatcacc       420
     cccgccatcg tgctggcccg ggtcagaaac cacctggagc tgaaagccgc gcgggatctg       480
     ctgcacgacc agaacgcctt tctggagcag gaggtggagc ggcgcacccg ggagaacgaa       540
     ctgatccaga acatcaccat ccactccctc gcctcgcttg ccgaaacccg cgacaacgag       600
     accggcaacc atatcttgcg cacccagcac tatgtgcggc tgctggcgga aaccctctgc       660
     gagcaccccc gctttcgtgc cgagctgacc cccaagacca tcgatctgct gttcaaatcg       720
     gccccgctgc acgacatcgg caaggtcggt gtgccggacc ggatcctgct caaacccggc       780
     aagctggatg cggacgagtt tgcccagatg aagcaccact ccattctcgg caaggaggcc       840
     atcgtccatg ccgaggaggc gctgggggtg gaggtggagt ttctgcggct ggccaaggag       900
     atcgcctgct accaccacga gaagtgggac ggcaccggct acccctatgg cttgatcggt       960
     gacgagatcc ccctctcggc ccgcttgatg gcgctggccg acgtgtacga cgccctcatc      1020
     agcaagcgct gctacaaggc cgccatgtcc caccaggagg tggtgcccat catactggcg      1080
     gggcggggca atcactttga ccccgacatc acggacgcct ttgcccgcat ccaccagcag      1140
     ttccacgaga tcgccctgcg ctacaacgac gacaagggcg aacgggagtc caaccgcgac      1200
     tag                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page