(data stored in ACNUC7421 zone)

EMBL: CP000462.PE403

CP000462.PE403       Location/Qualifiers
FT   CDS_pept        complement(452450..452713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36698"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD4"
FT                   /protein_id="ABK36698.1"
FT                   /translation="MSEPTEFFDEQTLLEMVDNQLSDGHPLQVKATLMRLVMKGTPREE
FT                   TLQYIACALGAELMAMEADQGPFNLERYGQFLDSLPEMPWAE"
     atgagcgaac ccaccgagtt cttcgacgaa caaaccctgc tggagatggt cgacaaccag        60
     ctgagcgacg gccacccgct gcaggtcaag gcgaccctga tgcggctggt gatgaagggc       120
     accccccgtg aagagacgct gcaatatatc gcctgtgcac taggggccga gctgatggcg       180
     atggaagcgg atcagggccc cttcaacctc gagcgctacg gccagtttct ggactccctg       240
     cccgagatgc cctgggccga ataa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page