(data stored in ACNUC7421 zone)

EMBL: CP000462.PE407

CP000462.PE407       Location/Qualifiers
FT   CDS_pept        complement(455122..456399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0431"
FT                   /product="NhaP-type Na+/H+ and K+/H+ antiporters"
FT                   /note="identified by match to protein family HMM PF00999"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38924"
FT                   /db_xref="GOA:A0KFD8"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD8"
FT                   /protein_id="ABK38924.1"
FT                   /translation="MSVYYTLCFLAALAIFIAFANQYVVKIQTTIAITAGSMLISALLV
FT                   LFGKLGWFNLEPLAVKTMESIDFQNFLLKGILGFLLFAGGLGINLKALRSQKWEITILS
FT                   IVATLLSTFMVGYGFWFIAKLLGWELPLVYCMLFGALISPTDPIAVLAIVKKMKAPPQI
FT                   AIQIEGESLFNDGVGLVIFATVFAVAFGGVEPTFGSVAGLFLHEALGGILFGAVLGLIT
FT                   HVMISATDDGSLELLLTLCIPTAGFAFANMIGVSGALAMVVTGIMIGNWTRHSGFSEQS
FT                   SHHLDHFWELMDQFLNALLFLLIGLALVLLDLAWRDWILLVIAVPLCLAARFISVSLPY
FT                   MAFRRYRSYNKFSVRILTWGGLRGGLAMAMALALPSGVMMLPEHGVDLREVILVMTYSV
FT                   VMFSIVVQGMTITPMITAAKKASGHY"
     atgagcgtct actacacact ctgcttcctg gcagcgttgg cgatctttat cgcctttgcc        60
     aatcagtatg ttgtgaagat ccagaccacc atcgccatca ccgcgggctc catgctgatc       120
     tccgcgctgc tggtgctgtt cggtaagctg ggctggttca atctggaacc cctggccgtc       180
     aagaccatgg agagcatcga cttccagaat ttcctgctga aggggatcct gggcttcctg       240
     ctgttcgccg gcggtctcgg gatcaatctg aaagccctgc gcagccagaa gtgggagatc       300
     accattctct ccatcgtggc gaccctgctc tccaccttca tggtcggcta cggcttctgg       360
     ttcatcgcca agctgctggg ctgggagctg ccgctggtct attgcatgct gttcggtgcc       420
     ctgatctccc ccaccgaccc catcgccgta ctggccatcg tcaagaagat gaaggcgccg       480
     ccccagatcg ccatccagat cgaaggggag tcgctgttca acgacggtgt cggcctggtg       540
     atcttcgcca ccgtgttcgc cgttgcattc ggcggcgtcg agcccacctt cggcagcgtg       600
     gccggcctgt tcctgcatga ggccctcggc ggcatcctgt tcggcgccgt gctgggcctc       660
     atcacccacg tgatgatcag cgccaccgac gatggttcgc tggagctgct gctgaccctc       720
     tgcatcccca ccgccggctt cgccttcgcc aacatgatcg gcgtctccgg cgccctggcc       780
     atggtggtga ccggcatcat gatcggcaac tggacccgtc actccggctt ctccgagcag       840
     agcagccatc acctggatca cttctgggag ttgatggacc agttcctcaa tgccctgctg       900
     ttcctgctga tcggtctggc gctggtgctg ctggatctgg cctggcgtga ctggatcctg       960
     ctggtcatcg cggtaccgct ctgcctcgcc gcccgcttca tcagcgtgtc gctgccctac      1020
     atggccttcc gccgctatcg cagctacaac aagttctcgg tgcggatcct cacctggggc      1080
     ggcctgcgcg gcggtctggc catggccatg gcgctggcgc tcccctccgg cgtcatgatg      1140
     ctgccggaac acggcgtcga cctgcgggaa gtgatcctgg tgatgaccta ctcggtggtg      1200
     atgttctcca tcgtggtaca aggcatgacc atcactccga tgatcaccgc cgccaagaag      1260
     gccagcggcc actattga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page