(data stored in ACNUC7421 zone)

EMBL: CP000462.PE409

CP000462.PE409       Location/Qualifiers
FT   CDS_pept        460466..461422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0433"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /note="identified by match to protein family HMM PF02655;
FT                   match to protein family HMM TIGR00768"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38151"
FT                   /db_xref="GOA:A0KFE0"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFE0"
FT                   /protein_id="ABK38151.1"
FT                   /translation="MAPYTLPPHPAQALPSSGIVMKIAILSREPNNYSTRRLVEVAQAR
FT                   GHQVEVLDTLRCYMNIASHNPSIHYEGRELESYDAVIPRIGASITFYGTAVLRQFEMMN
FT                   TMALNSSVAISRSRDKLRAMQLLSRHGIGLPVTGYAHSTHDVPDLITMVGGAPLVVKLL
FT                   EGTQGIGVVLCETQKAAESVIEAFIQTNNNILVQEYIREANGADIRCLVVNGKVVAAMR
FT                   RQAQPGEFRSNLHRGGTAEAIKISPEERATAVQAAKIMGLDVAGVDILRSARGPLVLEV
FT                   NSSPGLQGVEAASGKDVAGKIIEFLELKASRKHKPAE"
     gtggcacctt atactctccc gccccatcct gcccaggcac tgccttctag cggaattgtc        60
     atgaagatcg ccattttatc ccgtgagccc aacaactact ccacccgccg tctggtcgag       120
     gtggcgcagg cgcgcggtca tcaggtcgag gtgctcgaca ccctgcgctg ttacatgaac       180
     atcgcctccc acaacccctc catccactac gaaggacggg aactggagag ctatgatgcg       240
     gtgatcccgc gcatcggggc cagcatcacc ttctacggca ccgccgtgct gcgccagttc       300
     gagatgatga acaccatggc gctcaacagc tcggtggcca tctcccgctc ccgcgacaag       360
     ctgcgggcca tgcagctgct ctcccgccac ggcatcggcc tgccggtgac cggctatgcc       420
     cacagcaccc acgacgtgcc cgacctcatc accatggtgg gcggtgcgcc gctggtggtg       480
     aagctgctgg aggggaccca ggggatcggc gtggtgctgt gcgagaccca gaaagcggcc       540
     gagagcgtga tcgaggcttt catccagacc aacaacaaca tcctggtgca ggagtacatc       600
     cgcgaggcca acggcgccga catccgctgt ctggtggtca acggcaaggt ggtggccgcc       660
     atgcgccgcc aggcccagcc gggggagttt cgctccaacc tgcatcgggg cggcactgcc       720
     gaggcgatca agataagccc ggaagagcgg gccaccgcgg tgcaggccgc caagatcatg       780
     gggctggacg tggccggggt ggatatcctg cgcagtgccc gcggtccgct ggtgctggag       840
     gtgaactcct cccccggcct gcaaggggtg gaagctgcct ccggcaagga cgtggcgggc       900
     aagatcatcg agtttctcga gctcaaggcg agtcgcaagc acaagccggc ggagtga          957
//

If you have problems or comments...

PBIL Back to PBIL home page