(data stored in ACNUC7421 zone)

EMBL: CP000462.PE413

CP000462.PE413       Location/Qualifiers
FT   CDS_pept        465736..466215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0437"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35842"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE4"
FT                   /protein_id="ABK35842.1"
FT                   /translation="MTRTSLLLLTLPLCALAADGELWLVELEHNDGLRLQFQGAELELG
FT                   NAALSGVAGNDELRPGMRLAILSRDGVAERIGMADAIAGFLPTSQWRRAEASLLAVTGR
FT                   ALRLQGLGVLAFDDDTRWLNGSPADLQPGRKLVLSRNEQGCLTEILIANPEDEPE"
     atgacacgca cttccctcct gctgctgaca ctgccgctct gcgctctggc cgccgatggc        60
     gagctctggc tggtggagct ggaacacaac gatggcctgc gcttgcagtt tcagggcgcc       120
     gaactcgaac tcggcaacgc cgcgctgagc ggggtggcag gcaacgatga gctcagaccc       180
     ggcatgcgtc tggccatcct cagtcgtgac ggggtcgccg agcggatcgg catggccgac       240
     gccatcgccg gattcttgcc gaccagccag tggcgccggg ccgaagcctc gctgctggcc       300
     gtcacgggcc gcgccctgcg gctgcagggg ctcggcgtgc tggccttcga tgacgatacc       360
     cgctggctaa acggcagccc ggccgacctg caaccaggcc gcaagctggt gctcagtcgt       420
     aatgagcagg gctgcctgac cgaaatcctg atcgccaatc cggaagatga accagaataa       480
//

If you have problems or comments...

PBIL Back to PBIL home page