(data stored in ACNUC7421 zone)

EMBL: CP000462.PE415

CP000462.PE415       Location/Qualifiers
FT   CDS_pept        468494..470485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0439"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39508"
FT                   /db_xref="GOA:A0KFE6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE6"
FT                   /protein_id="ABK39508.1"
FT                   /translation="MSTNVSDTAKSSRREQRSSAQTFIDNLKGMAHPNSRRIFIEGSRA
FT                   DIRVPLREIQLADTFVGGTKEAPQFEPNEPVPVYDTSGRYGEEGVAIDVRRGLPRLRED
FT                   WVLERADTEALEGLSSTFTQERLADEGLDHLRFEHLPSARRAKPGRRVTQLHYARTGIV
FT                   TPEMEFIALRENMGRERVRSELLRTQHPGQGFGARLPQNITPEFVRDEVAAGRAIIPSN
FT                   INHPEAEPMIIGRNFLVKINANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLSTGRYI
FT                   HETREWILRNSPVPIGTVPIYQALEKTNGIAEDLTWELFRDTLLEQAEQGVDYFTIHAG
FT                   VLLRFVPMTAKRLTGIVSRGGSIMAKWCLSHHKENFLYQHFREICEICAAYDVALSLGD
FT                   GLRPGSVYDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMHMIERNMTEQLEH
FT                   CHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWYGCAMLCYVTPKEHLGLPNKEDVKQ
FT                   GLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPDTARAYHDETLP
FT                   QESGKVAHFCSMCGPKFCSMKITQDVRDYAAKLEAVEIKMVGMDGQQERVVAEVESGMA
FT                   RMAETFKETGGEIYHQAAALKQAAGEEA"
     atgtctacca atgtatctga taccgccaaa tccagccgcc gcgagcagcg ctccagcgcc        60
     cagaccttta tcgacaacct caaggggatg gctcacccca actcccgccg catctttatc       120
     gaaggctccc gcgccgatat ccgggtcccc ctgcgggaaa tccagctggc cgacactttc       180
     gtcggcggca ccaaagaggc tccccagttc gagcccaacg agccggtgcc ggtctacgac       240
     acctcgggcc gttacgggga ggagggggtc gccatcgacg tgcgccgcgg cctgccgcgc       300
     ctgcgggaag actgggtgct ggagcgcgct gacaccgagg cgctggaagg gctaagctcc       360
     actttcactc aggagcgcct ggccgacgag gggctggatc acctgcgctt cgagcatctg       420
     ccgagcgctc gccgcgccaa gccgggccgc cgggtcaccc agctccacta cgcccgcacc       480
     ggtatcgtca cccccgagat ggaatttatc gccctgcgcg agaacatggg ccgcgagcgg       540
     gttcgctccg agctcttgcg cacccagcac ccgggccagg gctttggcgc cagactgccc       600
     cagaacatca cccccgagtt cgtgcgcgat gaggtggccg ccggccgcgc catcatcccc       660
     agcaacatca accacccgga agccgagccc atgatcatcg gccgcaactt cctggtgaag       720
     atcaacgcca acatcggcaa ctcggcggtt acctccagca tcgaagagga ggtggagaag       780
     ctggtgtggt ccacccgctg gggcgccgac acagtcatgg atctctccac cggccgctac       840
     atccacgaga cccgcgagtg gatcctgcgc aacagcccgg tgcccatcgg taccgtgccc       900
     atctaccagg cgctggagaa gaccaacggc atcgccgaag acctcacctg ggagctgttc       960
     cgcgacaccc tgctggagca ggccgagcag ggggtggact acttcaccat ccacgccggc      1020
     gtcctgctgc gcttcgtgcc catgaccgcc aagcgcctca ccggcatcgt ctcccgcggc      1080
     ggcagcatca tggccaagtg gtgcctctcc catcacaagg agaacttcct ctaccagcac      1140
     tttcgcgaga tctgcgagat ctgcgccgcc tatgacgtgg ccctgtcgct gggcgatggt      1200
     ctgcgtccgg gctccgtcta tgacgccaac gacgaggccc agttcgccga gctgcacacc      1260
     ctgggcgagc tcaccaaaat tgcgtgggag tacgacgtgc aggtgatgat cgaggggccg      1320
     ggccacgtgc cgatgcacat gatcgagcgc aacatgaccg agcagctgga gcactgccac      1380
     gaggcgcctt tctatacctt gggcccgctc accaccgaca tcgcgccggg ttacgatcac      1440
     ttcacctccg gcatcggcgc cgccatgatc ggctggtacg gctgcgccat gctctgctac      1500
     gtgaccccca aggagcacct gggcctgccc aacaaggagg acgtgaagca ggggctgatc      1560
     acctacaaga tcgccgccca cgccgcggat ctggccaagg gccacccggg cgcccagatc      1620
     cgcgacaacg ccatgtccaa ggcgcgcttc gagttccgct gggaggatca gttcaacctg      1680
     gccctggatc ccgacaccgc ccgcgcctat cacgacgaga ccctgcccca ggagtccggc      1740
     aaggtggccc acttctgctc catgtgcggg cccaagttct gctccatgaa gatcacccag      1800
     gacgtgcgcg actacgccgc caagctggaa gcggtggaga tcaagatggt gggcatggac      1860
     ggccagcagg agcgggtcgt ggccgaggtg gagagcggca tggcccgcat ggccgaaacc      1920
     ttcaaggaga ccggcggcga gatctaccat caggcggcgg cactgaaaca ggccgcaggg      1980
     gaggaggcgt ga                                                          1992
//

If you have problems or comments...

PBIL Back to PBIL home page