(data stored in ACNUC7421 zone)

EMBL: CP000462.PE42

CP000462.PE42        Location/Qualifiers
FT   CDS_pept        49441..49899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0046"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39790"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEC5"
FT                   /protein_id="ABK39790.1"
FT                   /translation="MAEIEALIQRLWRQLPQIGAFAFTASNAEGSATDWCGSGEGEVVV
FT                   TDHQGGWLFAEQGRYTTPHGRVLAMHNRFWWQRGEQGIRLSHLRYEQPVVLFELLPQAD
FT                   GCWLTAEPHLCGQDHYSAELTPSGDGFLLGWQITGPRKNERLSYRYQE"
     atggccgaga tagaagcctt gatccagcgt ttatggcgcc agttgccaca gatcggagca        60
     tttgccttta ccgcgagcaa cgcggaaggc tccgccaccg actggtgcgg cagtggcgag       120
     ggggaggtgg tggtgaccga tcatcagggg ggctggctgt ttgccgagca gggccgctac       180
     accacgcccc atggccgggt gctggccatg cacaaccgct tctggtggca gcgcggcgag       240
     caggggatcc ggctttccca tctgcgctac gagcagccgg tggtgctgtt cgagctgctg       300
     ccgcaggcgg atggttgctg gctcaccgcc gagccccacc tgtgcggtca ggatcactac       360
     agcgccgagc tgacgccgag cggggacggc tttctgctcg gctggcagat caccggtccg       420
     cgcaagaatg agcgactcag ctatcgctat caggagtga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page