(data stored in ACNUC7421 zone)

EMBL: CP000462.PE421

CP000462.PE421       Location/Qualifiers
FT   CDS_pept        476309..478207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFF2"
FT                   /protein_id="ABK38863.1"
FT                   /translation="MVYVMIRQITITNFRSIRKETISTEEITTFVGKNDAGKSNLLRAL
FT                   NLFFNGKTDADTDYNFQSDFNINAIVQQRKAKEIKVELVLKLPRSYRKPDQPDTVYWSK
FT                   IWRADGFHDEVQQHCEVKGGAVVNKRNFPKRSKIPSLLKSINYIYIPAIKDANFFRDLQ
FT                   GKLYDVLAISSEQGLHASANSFEQEINEHISELMGEIDTVFASSNNEIKLPQNLRNIFG
FT                   ALEFKADNIPLSRRGDGIKIRHIPMMLSFIALKQQSIGAKITIRPQIWGFEEPENNVEF
FT                   STCFELNNQLIEAAKKHTQMFITTHSPAIYSLSFNASLPSGLKSISYYVDKKGHDTKLQ
FT                   SCSEQDLHGNTGFLNLVTPLIEEHRKVWQERESEYKKTLGVLSSQLAASSKPRVFLEGM
FT                   SDSVVINRILQFLNKADEIFIDVPDNAHNSANAASDRAKAFYLLQKHEKTKVLGLLLLD
FT                   DDPAGKEAKNQFTEFFKGQQSTVSAATYPPHDAPKKLKLKGYIWRVELEHLYPECIWQH
FT                   ALEQSWIEEVTDEEQKFTDNKRKELFNTGVSPITYKADLTDYQRFIVDYAFTHQGKRDV
FT                   SQYIDNMTDDELFEKGLVAAFEPVIEMILKKLKLSPIASEISASEDSETSPIWTGT"
     ttggtatatg tcatgattag gcaaattact attactaact ttcgttctat acgcaaagag        60
     actatttcaa cggaagaaat tacaactttt gtgggtaaga atgatgcagg taaatcaaac       120
     ctactcagag cattaaactt attttttaat ggtaaaacgg atgccgatac tgactataat       180
     tttcagtcag attttaatat caatgctatt gttcagcaac gaaaggcaaa ggaaattaaa       240
     gtagagttgg ttctaaaact tcctcgaagt tatcgtaagc cagatcagcc agacacagta       300
     tattggagta aaatatggcg tgctgatggc ttccacgatg aagttcaaca acattgtgaa       360
     gttaaaggtg gtgcagtagt aaataagagg aatttcccta agcgaagtaa aatacctagt       420
     ctattgaaaa gcataaacta catttacatt cctgctatca aggacgctaa tttctttcga       480
     gatttgcaag gtaagctata cgatgtattg gctatttcat cagagcaagg cctgcacgct       540
     tcagcaaata gttttgagca agaaatcaat gagcatatca gtgaattgat gggggagatt       600
     gatacggtct tcgcgagtag taataacgag attaaacttc ctcagaattt aagaaatata       660
     tttggtgctc tagagtttaa agccgacaat atacccctaa gccgtagggg ggatgggata       720
     aaaattagac atatccccat gatgctctcg ttcattgctc taaaacagca aagtatcggt       780
     gcgaaaataa ctattcggcc tcagatctgg gggtttgaag aaccagaaaa caatgttgag       840
     ttctctacat gcttcgagct gaataatcag ctaattgagg ctgctaaaaa acacacacag       900
     atgtttataa caacacactc tcctgccata tattcacttt cgttcaacgc ttcattgcca       960
     tctggtctaa agagcattag ctattacgtt gacaaaaagg ggcatgatac taagctacaa      1020
     tcatgtagtg agcaggatct tcacggtaat acaggttttt taaaccttgt aacaccattg      1080
     attgaagagc atcgaaaggt atggcaagag cgagagagtg aatataagaa aacattaggt      1140
     gttttgtcgt ctcaattagc agcgtcttcc aagccaagag tatttctaga aggtatgagt      1200
     gatagcgttg taatcaatag aattttgcaa ttcttgaaca aggctgatga aattttcatt      1260
     gatgttccag ataacgctca caatagcgca aatgctgcta gtgatagagc aaaagcattt      1320
     tatttgcttc agaaacatga aaaaacaaaa gttctaggtt tgctcttgct ggatgatgac      1380
     cctgcgggta aagaagcaaa aaatcagttc acggaatttt ttaagggtca gcaatcgacc      1440
     gtgagcgctg caacataccc ccctcatgat gcacctaaga aattgaaact taagggttat      1500
     atttggaggg tggagttgga acacctatat ccagagtgta tttggcagca tgcattagaa      1560
     caatcttgga ttgaggaagt tactgatgaa gagcaaaaat ttaccgataa taagcgcaag      1620
     gaattattta atactggtgt gagcccaatc acatataagg ctgatttaac tgattaccag      1680
     aggtttatcg ttgattatgc tttcacgcat caaggcaagc gcgatgtaag tcaatacatt      1740
     gataatatga ccgatgatga attatttgaa aaaggccttg ttgcagcttt cgaacccgta      1800
     attgagatga ttcttaagaa gctaaagctg tcacctatag catcagaaat atcagcctcc      1860
     gaagattctg agacatcccc catttggaca ggcacgtaa                             1899
//

If you have problems or comments...

PBIL Back to PBIL home page