(data stored in ACNUC7421 zone)

EMBL: CP000462.PE432

CP000462.PE432       Location/Qualifiers
FT   CDS_pept        486247..486612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0457"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01638"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37876"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG3"
FT                   /protein_id="ABK37876.1"
FT                   /translation="MSPLPCPAYRVLRLLAGKWKPAILFHLRAQILRFGDLRRSLPEVS
FT                   QKVLTAQLKELESDGVIIRTLYPDVPPRVEYSLSPLGIALLPLLQQMHDFALSHGSLLA
FT                   QSEAGAAREEPHLGEPG"
     ttgtccccac tgccctgtcc cgcctaccgg gtgctgcgcc tgctggccgg caaatggaaa        60
     ccggccatcc tgtttcatct gcgcgcgcag atcctgcgct ttggcgatct gcgccgcagc       120
     ctgcccgagg tgagccagaa ggtgctcacc gcccagctca aggagctgga gagcgacggc       180
     gtcatcatcc gcaccctcta ccccgacgtg ccgccccggg tggagtacag cctgagcccg       240
     cttggcatcg ccctgctccc cctgcttcag cagatgcacg acttcgcgct gagccacggc       300
     tctctgctgg cgcagagcga agcgggggcg gcccgcgagg agccccatct cggcgagccc       360
     ggttaa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page