(data stored in ACNUC7421 zone)

EMBL: CP000462.PE433

CP000462.PE433       Location/Qualifiers
FT   CDS_pept        complement(486609..487043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0456"
FT                   /product="acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38476"
FT                   /db_xref="GOA:A0KFG4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG4"
FT                   /protein_id="ABK38476.1"
FT                   /translation="MQIRPFTPADTEAVLAIWLEASLQAHHFIEPAYWHANLAPMREIY
FT                   LPAADSQLLCLGEQVLGFYSLHEGTLAALFVAPARQGQGLGKALLEHAKQRLPTLRLQV
FT                   YQQNRTACDFYRAQGFQVAAGGVDPHTGCAEWVMIWPARD"
     atgcagatcc gccccttcac cccggccgac accgaggccg tcctcgccat ctggctggag        60
     gcctccctgc aggcccacca cttcatcgag cccgcttact ggcacgccaa cctggcgccg       120
     atgcgggaga tctatctgcc cgccgccgac agccagctgc tttgcctggg tgagcaggtg       180
     ctgggcttct actccctgca tgagggcacc ctggccgccc tcttcgtggc ccccgcgcgg       240
     caggggcaag ggctgggcaa ggccctgctc gagcacgcca aacagcggtt gccgaccctg       300
     cggctgcagg tctatcagca gaaccggacc gcgtgcgact tctatcgcgc gcaaggattt       360
     caggtggcgg cagggggtgt ggatccccac accggctgcg ccgagtgggt gatgatctgg       420
     ccggcgcggg attaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page