(data stored in ACNUC7421 zone)

EMBL: CP000462.PE434

CP000462.PE434       Location/Qualifiers
FT   CDS_pept        complement(487169..487858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36111"
FT                   /db_xref="InterPro:IPR016878"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG5"
FT                   /protein_id="ABK36111.1"
FT                   /translation="MGGKPIPPHSRLNGGFNFYSSQIDKLRVSLNATPRSHDRMKLLTK
FT                   TLFTKQSGLVLVLLAASGSLSAAQIANNNITEAEIKAAQDAWGKALIQISDDYRSGGID
FT                   KARATATAVLDGAYGYHHGPVLFKPTLAGGEQTFRINQAGALAYFVGNNQAYPADTGFA
FT                   LKNWQSYNYDNAAVYINGDMALTMGKVHLTDRDNKQTTVDKTWGFKKGDDGKVRIVLHH
FT                   SSLPYAG"
     atgggaggga agccgatccc tccccactca aggctgaatg gggggttcaa tttttattca        60
     tcgcagatag ataaactccg ggtctcctta aacgcgacac ccaggagtca cgaccgtatg       120
     aagttgctca ccaagacgtt gttcaccaag caatccggcc ttgtcctcgt tctgctcgcc       180
     gccagcggct ccctcagcgc cgcccaaatc gccaacaaca acatcaccga agccgagatc       240
     aaggccgcgc aggatgcctg gggcaaggcc ctgatccaga tcagcgatga ctaccgcagc       300
     ggcggcatcg acaaggccag agccaccgcc accgccgtgc tcgacggcgc ctacggctac       360
     caccatggcc ccgtgctgtt caagccgacc ctggccggcg gcgaacagac tttccgcatc       420
     aatcaggcag gggcgctggc ctacttcgtc ggcaacaatc aggcctatcc cgccgacacc       480
     ggcttcgccc tcaagaactg gcagagctac aactacgaca acgccgccgt ctacatcaac       540
     ggcgacatgg ccctcaccat gggcaaggtg cacctgaccg accgagacaa caagcagacc       600
     acggtcgaca aaacctgggg cttcaagaag ggggacgacg gcaaggtgcg catcgtgctg       660
     caccactcct ccctccccta cgccggctaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page