(data stored in ACNUC7421 zone)

EMBL: CP000462.PE437

CP000462.PE437       Location/Qualifiers
FT   CDS_pept        complement(489771..491813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0461"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36630"
FT                   /db_xref="GOA:A0KFG8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFG8"
FT                   /protein_id="ABK36630.1"
FT                   /translation="MHTPHHPRTLLSVALLALSAGAHAEDETMTVVGKRSQHEEVATAT
FT                   RTNTPAKLVPQAIDSVKASELTAFGQPTLSEALTGIPGVNASGDTRFDGVNIRGFSASN
FT                   DFYLDGFRDDMQYTRDLGNTERVEVLKGPAAVLYGRGSTGGIVNRVSKKPQKGLESSVS
FT                   AQVGSFDSRRLAADLNGEAGEQVQVRLNLAQEDKDSFRNGVTSKRTLLAPSVNWEISDK
FT                   LNWLVQYERNEHDRTPDRGIPGVNGRPADVPKEYVYSDTRRDFIDDVAQSTRSRLTWDI
FT                   NDQWQLRQQLGYTSLDSQFDNTYVTSVKGDQVTRSRWQQDLKANSLISNTEAEGQLQTG
FT                   PVEHRLLVGFEQNWQERTPKLYQNATAIPAGNLYDPGSLPTYDGAMKLSSDANHKVRGY
FT                   GLYVQDQLSLGDWHLLAGLRRDDFTVTSRRNDLNKEETVSVTSLSPRLGLVWNPIEEHA
FT                   FYASYSKTFTPVGGELIGITPGDKNNNLDPQHTRLYEGGVKSDWLDGRLATTLSLYRLE
FT                   MYNKRSKDPLDPTKVILTGLQRTEGIELSARAQLTDELYLRGGIAIQDAEQVKADADLQ
FT                   GKRPMNVSRQNGELFAGYQSGKQGWFGETGVTAVGDRFADNANTTTLPGYARFDARAGY
FT                   RWQQWETQLSVENLTDHDYFVSATSASQIMPGTPRQLHLSAAYRF"
     atgcacacac ctcaccaccc gcgcactctg ctgagtgtcg ccctgctggc cctgagcgcc        60
     ggcgcacacg ccgaagacga gaccatgaca gtggtcggca aacgcagcca acatgaagag       120
     gtcgccaccg cgacccgtac caacaccccg gccaagctgg tgccgcaggc catcgacagc       180
     gtcaaggcga gcgagctgac cgccttcggc cagcccaccc tgagcgaggc gctgaccggc       240
     atccccggcg tcaacgccag cggtgacacc cgcttcgatg gcgtcaacat ccgcggcttc       300
     agcgccagca acgacttcta tctggacggc tttcgcgacg acatgcagta cacccgcgac       360
     cttggcaaca ccgagcgggt cgaagtgctc aaggggccgg cagcggtgct ctatggccgt       420
     ggcagcacag gtggcatcgt caaccgggtc agcaagaagc cgcagaaggg gctggagtcc       480
     agcgtcagcg cccaggtcgg cagcttcgac agccgccggc tggccgccga cctcaacggt       540
     gaagcgggtg aacaggtgca ggtgcgcctc aacctggctc aggaagacaa ggacagcttt       600
     cgcaacggcg tgaccagcaa gcgtaccctg ctggccccct ccgtcaactg ggagatcagc       660
     gacaagctga actggctggt gcagtacgag cgcaacgagc acgaccgcac cccggatcgc       720
     ggcatccccg gcgtcaacgg ccggccggcc gacgtgccga aggagtatgt ctacagcgat       780
     acccgccgcg acttcatcga cgatgtggcc cagtccaccc gttcgcgcct cacctgggac       840
     atcaacgatc agtggcaact gcgccagcag ctgggctaca ccagcctcga cagccagttc       900
     gacaacacct atgtcaccag cgtgaagggg gatcaggtga cccgctcccg ctggcagcag       960
     gatctcaagg ccaatagcct gatcagcaac accgaggccg aaggccagct gcagaccggc      1020
     cccgtcgagc accgtctgct ggtgggcttc gagcagaact ggcaggagcg cacccccaag      1080
     ctctaccaga acgccaccgc gatcccggcc ggcaacctct atgatccagg ctccctgccc      1140
     acctacgacg gcgccatgaa gctctccagc gacgccaacc acaaggtgcg tggctacggc      1200
     ctctatgtgc aggatcagct cagcctgggc gactggcacc tgctggcggg tctgcgccgc      1260
     gacgacttca ccgtcaccag ccgccgcaac gacctcaaca aggaggagac cgtctcggtc      1320
     accagcctga gcccgcgcct gggcctggtg tggaacccga tcgaggagca cgccttctac      1380
     gcctcctaca gcaagacctt caccccggtg ggcggcgagc tgatcggcat caccccgggc      1440
     gacaagaaca acaacctgga tccccagcac acccggctgt acgagggcgg cgtgaagagc      1500
     gactggctgg atggccgcct ggcgaccacc ctctccctct accggctgga gatgtacaac      1560
     aagcgcagca aggatccact ggatcccacc aaggtgatcc tcaccggtct gcagcgcacc      1620
     gaggggatcg agctgagcgc ccgcgcccag ctgaccgacg agctctacct gcgcggcggc      1680
     atcgccatcc aggatgccga gcaggtcaag gctgacgccg atctgcaagg caagcggccg      1740
     atgaacgtct cccgccagaa cggcgagctg ttcgccggct atcagagcgg caagcagggc      1800
     tggttcggcg agaccggggt gaccgcggtg ggcgatcgct tcgccgacaa cgccaacacc      1860
     accaccctgc ccggttacgc ccgcttcgac gcccgtgccg gctaccgctg gcagcagtgg      1920
     gaaacccagc tgagcgtgga gaacctgacc gatcacgact acttcgtcag cgccaccagc      1980
     gcctcccaga tcatgccggg cacaccccgt cagctgcatc tgagcgccgc ctaccgcttc      2040
     tga                                                                    2043
//

If you have problems or comments...

PBIL Back to PBIL home page