(data stored in ACNUC7421 zone)

EMBL: CP000462.PE441

CP000462.PE441       Location/Qualifiers
FT   CDS_pept        495522..495773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0465"
FT                   /product="proteinase inhibitor"
FT                   /note="identified by match to protein family HMM PF03692"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39082"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH2"
FT                   /protein_id="ABK39082.1"
FT                   /translation="MECRQGCGACCIAPSISSAIPGMPDGKPAGVPCVQLDARLGCKIF
FT                   GQPERPAVCGGFRPMQDVCGYHREEAIWLIGELERMTS"
     atggaatgtc gtcaaggttg cggtgcctgc tgcatcgccc ccagtatcag cagtgccatt        60
     cccggcatgc ccgacggcaa accggccggc gtgccctgcg tgcagctcga tgcgcggctg       120
     ggctgcaaga tcttcggcca gcccgagcgg ccggcggtgt gcggcggctt tcgtcccatg       180
     caggacgtgt gcggctatca ccgggaggag gccatctggc tcatcggtga actggagcga       240
     atgacgtcct ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page