(data stored in ACNUC7421 zone)

EMBL: CP000462.PE442

CP000462.PE442       Location/Qualifiers
FT   CDS_pept        complement(495930..497093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0466"
FT                   /product="HemY protein"
FT                   /note="identified by match to protein family HMM PF07219;
FT                   match to protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39531"
FT                   /db_xref="GOA:A0KFH3"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH3"
FT                   /protein_id="ABK39531.1"
FT                   /translation="MIRLIVLVAAMVAGLIFGPQASGNKGYVLISLGNYTVESSVTSAV
FT                   ILAVLFYGALLIVEWLLGRVFGLRRKTLGWYGSRRRRKANQQTVAATLAMAEGHYSQAE
FT                   KLMLKGASNSDTPLLNYLSAAKAAQARGDDVRRDQYLQKAQEENPKAELALTLTQTQLQ
FT                   IEQGQYDTALAMLESVYALNPRHPMVLDQLRQVHLAREDWAALIDLIPVLHKVGKLTPK
FT                   QEEDLLQQAWRGRLDAASGALETLRPIWQELPRKLRQDPDLLAAYGDRLRQLGADNEAA
FT                   ELWLDALRKQVSPQLLARLPKLKLDSYQPMLTLLQKIQDQPGVDAALAQVYLLAGQLDD
FT                   AQRLLEQEVAKAPNAAVYHALGQVMDKRRLTNKANEYYRQALQLADV"
     atgattcgtc tgattgtact ggtggccgcc atggtggcgg gcctcatctt cggcccgcag        60
     gcctccggca acaagggcta tgtgctgatc tcgctgggca actacacggt tgaatcttcg       120
     gtcaccagcg cggtgatcct ggcggtgctg ttctacggtg ccctgctcat cgtcgagtgg       180
     ctgctgggcc gggtattcgg cctgcgccgc aagaccctgg gctggtacgg ctcgcgccgg       240
     cgccgcaagg ccaaccagca gaccgtggcc gccaccctgg ccatggccga ggggcactac       300
     agccaggccg agaagctgat gctcaagggc gccagcaaca gcgacacccc gctgctcaac       360
     tacctgagcg ccgccaaggc ggcccaggcc cgtggcgatg acgtgcgccg ggaccaatac       420
     ctgcaaaagg cgcaggaaga gaatcccaag gccgagctgg cgctgaccct gacccagacc       480
     cagctgcaga tcgagcaggg ccagtacgat accgcgctgg ccatgctgga atccgtctat       540
     gccctcaacc cgcgccaccc catggtgctg gaccagctgc gccaggtgca cctggcccgc       600
     gaggactggg ctgccctcat cgatctcatc ccggtgctgc acaaggtggg caagctgacc       660
     cccaaacagg aagaagacct gctgcagcaa gcctggcgtg gccgcctcga cgccgccagc       720
     ggcgccctcg agaccctgcg cccgatctgg caggagctgc cgcgcaagct gcgccaggat       780
     ccggatctgc tggccgccta tggcgatcgc ctgcgccagc tgggagccga caatgaggcc       840
     gccgagctgt ggctggatgc gctgcgcaag caggtctcgc cccagctgct ggcccgtctg       900
     cccaagctca agctcgacag ctaccagccg atgctgaccc tgttgcagaa gatccaggat       960
     cagccgggcg tcgacgcggc gctggcccag gtctacctgc tggccggtca gctggacgac      1020
     gcccagcgcc tgctggagca ggaggtcgca aaagcgccga acgccgccgt ctaccacgcc      1080
     ctcggtcagg taatggacaa gcgccgcctc accaacaagg ccaacgagta ctaccgccag      1140
     gcattgcagc tggccgacgt ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page