(data stored in ACNUC7421 zone)

EMBL: CP000462.PE448

CP000462.PE448       Location/Qualifiers
FT   CDS_pept        complement(503487..503801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0472"
FT                   /product="protein CyaY"
FT                   /note="identified by match to protein family HMM PF01491"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39479"
FT                   /db_xref="GOA:A0KFH9"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFH9"
FT                   /protein_id="ABK39479.1"
FT                   /translation="MKDHEYHALTDAFFQYVEDTVDAGYPDIDCERAGGVLTLSFENKT
FT                   KVIINKQEPLHQIWVATRENGFHFELQGESWIDNRFGHELKTLLSKACTTQAGEPVQFP
FT                   "
     atgaaggatc acgagtatca cgccctgacc gacgcctttt tccaatatgt ggaggacacc        60
     gtcgacgcag gatatccgga tattgactgt gagcgtgccg gcggggtctt gaccctgtcg       120
     ttcgagaaca agaccaaggt catcatcaac aagcaggagc ccctgcacca gatctgggtc       180
     gccacccgcg agaacggctt ccacttcgag ctgcaagggg aaagctggat cgacaaccgc       240
     ttcggtcacg agctcaagac gctgctgagc aaggcctgca ccacccaggc gggtgaaccc       300
     gtccagttcc catga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page