(data stored in ACNUC7421 zone)

EMBL: CP000462.PE45

CP000462.PE45        Location/Qualifiers
FT   CDS_pept        51191..52165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0050"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38266"
FT                   /db_xref="GOA:A0KR08"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR08"
FT                   /protein_id="ABK38266.1"
FT                   /translation="MELPLSRLDLNLLTVFDMLMQERNVTRAAERLHLSQSTVSHALGR
FT                   LRTALDDPLFVMSRREMMPTERAKALAGPVRQALAMLEQGLRQAKGFDPASARRIFRIA
FT                   TPGSVEHGLVPALVERLHRHAPHCRLEVCELADSDYERELEKGELDLVIGFADANHLSP
FT                   RLWREPWFNNPLVCLSPLGSELPDVLGPDDLVSRPHIHTSSWGHSQAMVDLWLARFGVE
FT                   RELGVRLPSFMAVPPLMATGRYLVVVPEMIGRHFCRYYPLRLHQLDPDIPIVYLMAGHP
FT                   LTAHDEAIGWFKGLLHRLAFERYGADALGSPAQRGADQFNPAK"
     atggaactgc ccctttcccg cctcgacctc aacctgctca ccgtgttcga catgctgatg        60
     caggagcgca acgtcacccg tgctgccgag cggctacatc tctcccagtc caccgtcagt       120
     catgcgctgg ggcggctgcg aacggcgctg gacgaccctc tgttcgtgat gagccggcgc       180
     gagatgatgc cgaccgagcg cgccaaggcg ctggccggcc cggtgcgcca ggcgctggcc       240
     atgctggagc aggggttgcg gcaggccaag gggttcgacc ccgccagtgc gcggcggatc       300
     tttcgcatcg ccactccggg ctcggtggaa cacggtctgg tgccggcgct ggtggagcgg       360
     ctgcaccggc atgccccgca ctgccggctg gaggtgtgcg agctggcgga cagcgactac       420
     gagcgggagc tggagaaggg ggagctggat ctggtgatcg gcttcgccga tgccaatcac       480
     ctctcgcccc ggctgtggcg cgaaccctgg ttcaacaacc cgctggtctg tctgtctccc       540
     cttggcagcg aactgcctga cgtgctgggg ccggacgatc tggtcagccg gccccacatc       600
     cacacctcca gctggggcca cagtcaggcc atggtggatc tctggctggc ccgcttcggg       660
     gtggagcgtg aactgggtgt ccgattaccg agctttatgg cggtgcctcc gctgatggcc       720
     accggtcgct atctggtggt ggtgcccgag atgatcgggc gccacttctg ccgctactac       780
     ccgctgcggc tgcaccagct ggaccccgac atccccatcg tctatttgat ggcgggccac       840
     ccgctcaccg cccatgacga ggcgatcggc tggttcaagg ggttgttgca ccggctggcg       900
     ttcgagcgct acggcgcgga tgcgctcggc agcccggcgc agcgcggggc ggatcagttc       960
     aatccggcga agtag                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page