(data stored in ACNUC7421 zone)

EMBL: CP000462.PE454

CP000462.PE454       Location/Qualifiers
FT   CDS_pept        complement(508799..509209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38422"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI5"
FT                   /protein_id="ABK38422.1"
FT                   /translation="MHFMLLTALALSATLQFDCPATIETRQQLLGASPGWQAVTRNDMG
FT                   EQHQPLSHRLDNLALFDGDPDERAQLKPDNGDSDALHYWSLDRRNPRPFYLVCHYRETA
FT                   ITLQQALPTGISYCRVNQPDPYQLRGLICRNE"
     atgcatttca tgctgttgac cgcactggcc ctgagcgcca ccctgcaatt tgactgcccc        60
     gcgaccattg aaacccgcca gcagctgctg ggggccagcc cggggtggca ggccgtcacc       120
     cgcaacgata tgggggaaca acaccagccc ctcagccacc ggctggacaa cctggccctg       180
     ttcgacggcg accccgatga gcgagcccag ctcaagccgg acaacggcga cagcgacgcg       240
     ctgcactact ggagtctgga tcgccgcaac cctcgcccct tctatctggt ctgccactat       300
     cgggagaccg ccatcaccct gcagcaggcg ctgcccaccg gcatcagcta ctgccgggtc       360
     aaccagcccg atccttacca gctgcgcggg ctgatctgcc gcaacgagtg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page