(data stored in ACNUC7421 zone)

EMBL: CP000462.PE456

CP000462.PE456       Location/Qualifiers
FT   CDS_pept        510884..511297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0480"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36907"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI7"
FT                   /protein_id="ABK36907.1"
FT                   /translation="MRTLNKMVWIAGAWLLTGCDQLADKYRVEFRDGSWREIAITPFAD
FT                   EARWREGCATGEVLSDMMLPLKRGKTVNGREQLLIGGELFELDDSALYRSNGMVFGHTP
FT                   DHIQRGLKGLEVCRTLRPDRGALPKLKARGFGD"
     gtgcgcacgc tgaacaagat ggtctggatt gccggggcct ggttgctgac gggctgtgat        60
     cagctggccg acaagtatcg ggtcgagttt cgcgatggct cctggcgcga gatcgccatc       120
     acccccttcg ccgacgaggc gcgctggcgc gagggctgcg ccaccggcga ggtgctgagc       180
     gacatgatgc tgccgctcaa gcgcggcaag acggtcaacg gccgcgaaca gctcttgatc       240
     ggcggcgagc tgttcgagct ggacgacagc gccctctatc gcagcaacgg catggtgttt       300
     ggccacacgc cggatcacat ccagcgcggg ctgaaggggc tggaggtatg ccgaaccctg       360
     cgcccggatc gcggtgcgct gcccaagctc aaggcgcgcg ggttcggcga ctag             414
//

If you have problems or comments...

PBIL Back to PBIL home page