(data stored in ACNUC7421 zone)

EMBL: CP000462.PE457

CP000462.PE457       Location/Qualifiers
FT   CDS_pept        complement(511307..512077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0481"
FT                   /product="glutamine amidotransferase, class I"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF07722"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38360"
FT                   /db_xref="GOA:A0KFI8"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI8"
FT                   /protein_id="ABK38360.1"
FT                   /translation="MTRSPHTPRKPVVLMTTGAQPRNGHAYQVMTHKYIKPLVEISGCV
FT                   PLLVPTCCGTEDLAQYLDLADGVYLSGAGSNIDPALYGQENLTPEKQQDRDRDLFDIPL
FT                   VRAALDRGLPILGICRGMQEINVALGGDIHQKVYSEPGYDDHREDADDPVDDQYGESHQ
FT                   VELVPGSWLAELMGQPSIPVNSLHGQGIKTLAKGLEPLAHAEDGLIEAIHAPTLSPFLL
FT                   AVQWHPEWKASENPHSIKIFEAFGDACRARLSGL"
     atgactcgca gcccccacac cccgcgtaaa cccgtcgtac tgatgaccac gggcgcccag        60
     ccccgcaatg gccacgccta tcaggtgatg acccacaaat acatcaagcc gctggtggag       120
     atcagcggct gcgtgccgct gctggtgccc acctgctgcg gcaccgagga tctggcgcag       180
     tatctggatc tggcggatgg cgtctatctg agcggcgccg gctccaacat cgatcccgcc       240
     ctctacggcc aggagaacct caccccggag aagcagcagg acagggacag ggatctgttc       300
     gatatcccgc tggtgcgcgc cgccctcgac cgcggcctgc cgatcctcgg gatctgccgc       360
     ggcatgcagg agatcaacgt ggcgctgggg ggagacatcc accagaaggt ctacagtgaa       420
     ccgggttatg acgatcatcg ggaagacgct gacgatccgg tggacgatca gtatggcgag       480
     agccatcagg tcgagctggt gccgggcagc tggctggcgg agctgatggg acagccgtcg       540
     atcccggtca actcgctgca cggccagggg atcaagacgc tggccaaggg gctggagccg       600
     ctggcccatg ccgaagacgg gctgatcgag gcgatccacg cccccaccct ctcccccttc       660
     ctgctggcgg tgcagtggca cccggagtgg aaggcgagcg agaaccctca ctccatcaag       720
     atcttcgagg cctttggcga cgcctgccgg gcccgtctga gcggcctctg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page