(data stored in ACNUC7421 zone)

EMBL: CP000462.PE458

CP000462.PE458       Location/Qualifiers
FT   CDS_pept        complement(512439..513248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0482"
FT                   /product="phosphatase YidA"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37698"
FT                   /db_xref="GOA:A0KFI9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFI9"
FT                   /protein_id="ABK37698.1"
FT                   /translation="MYKLIALDMDGTLLNSQGQISPRTHAAIAAARAKGVTVVLASGRP
FT                   LEGMSRYLVELGLTGQDDYVICYNGALVQQVADQRIIRSQLLTGSDASAIAALADELGV
FT                   NVHGFSVSRGLISPRVSPYTEHESRLIDMPIKLLDFATLPADEQILKVMMIDPEPLLSP
FT                   AIAKLPAELYQRYTVVRSAPYFLEFMNKQSNKGTGVAALAEHLGLDASQVIAVGDAGND
FT                   HHMIEYAGLGVAMGNATDDIKALAQHTTGRNDEDGVAQVIERFILNA"
     atgtacaagc tgatcgcatt ggatatggat ggcaccctgt tgaactccca gggccagatt        60
     tccccccgca cccacgcggc cattgccgcc gcccgcgcca agggcgtcac cgtcgtgctg       120
     gcctcgggcc ggccgctgga ggggatgagc cgctatctgg tggaactcgg cctaaccggt       180
     caggatgact acgtcatctg ctacaacggt gccctggtgc agcaggtggc cgatcagcgc       240
     atcatccgca gccagctgct caccggcagc gatgccagcg ccatcgccgc cctggccgac       300
     gagctgggcg tcaacgtgca cggcttctcg gtgagccggg ggctcatcag ccccagggtc       360
     agcccctaca ccgagcacga atcccgcctc atcgacatgc ccatcaagct gctggacttc       420
     gccaccctgc ccgccgacga gcagatcctc aaggtgatga tgatcgatcc cgagccgctg       480
     ctctcccccg ccatcgccaa gctgccggcc gagctctacc agcgctatac cgtggtgcgc       540
     agcgccccct acttcctcga gttcatgaac aagcagagca acaaggggac cggcgtcgcc       600
     gccctggccg agcacctggg gctggatgcc tcccaggtca tcgcggtggg ggatgcgggc       660
     aacgatcacc acatgatcga gtacgccggg ctgggggtgg ccatgggcaa tgccaccgac       720
     gatatcaagg cgctggccca gcacaccacg gggcgcaacg atgaagacgg ggtcgcccag       780
     gtgatcgagc gtttcatcct gaacgcctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page