(data stored in ACNUC7421 zone)

EMBL: CP000462.PE463

CP000462.PE463       Location/Qualifiers
FT   CDS_pept        complement(518484..519641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0487"
FT                   /product="competence/damage-inducible protein CinA"
FT                   /note="identified by match to protein family HMM PF00994"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37416"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ4"
FT                   /protein_id="ABK37416.1"
FT                   /translation="MRIEIISTGDEIVTGLVVDTNAAWLSALLLEQGWQVRRRVTVGDN
FT                   LKDLKTVLAESASRAEVVLVCGGLGPTADDLTAQAAAEAFDQPLTLFPDWLATIEARYA
FT                   SRGRPMPASNAKQAWLPQGGEILDNPVGTACGFVVTHTGHQGPSLLFFTPGVPFEFKQM
FT                   VREQIMPRLKALAGAQTDTELRRFYTFGVSESALSDMLDAAPWPAGIELGYRSSMPLIE
FT                   LKLIGHGASAADMDAAEARLLAAIEPWLVGRGDKEPAQQILDLLGDKPLTLLEGESRGA
FT                   LLAMCHPHPALTASFSHALASELAQLAAPAAPLSLTIGRAGPDGVPLLLCVDGQLYGQT
FT                   LKVSHPDPDSGRRIIAFAALDMLRRQLQGLPVLGDYRTLARTASR"
     atgcgcatcg aaatcatcag caccggagac gagatagtga cgggcctggt ggtagacacc        60
     aacgctgcct ggctgagcgc cctgctgctg gagcagggct ggcaggtgcg ccgccgcgtc       120
     accgtggggg acaacctcaa ggacttgaaa accgtgctgg cagagagcgc cagccgtgcc       180
     gaggtggtgc tggtgtgcgg tgggctcggc cccaccgccg acgatctcac cgcccaggcg       240
     gcggccgaag ccttcgacca gccgctcacc ctgttcccag actggctcgc caccatcgaa       300
     gcgcgctacg ccagccgcgg caggcccatg ccagccagca acgccaaaca ggcctggctg       360
     ccgcaggggg gcgagatcct cgacaacccg gtcggcaccg cctgcggctt tgtggtcacc       420
     cacacaggcc accagggccc aagcctactc ttcttcaccc cgggcgtgcc gttcgaattc       480
     aagcagatgg tgcgcgagca gatcatgccg cgcctcaagg cgctggctgg cgcgcagacc       540
     gacaccgaac tgcgccgctt ttataccttc ggcgtctcgg agtcggccct cagcgacatg       600
     ctggatgccg ctccctggcc cgccggcatc gagctcggct accgctcctc catgccgctc       660
     atcgagctga agcttattgg ccacggcgcc agcgcggcgg acatggacgc cgccgaggcg       720
     cggctgctcg ccgccatcga gccctggctg gtagggcggg gcgataagga gccggcgcag       780
     cagatcctgg atctgttggg ggataaaccg ctgacgctgc tggagggtga gagccggggc       840
     gccctgctgg ccatgtgcca cccgcatccg gccctgacgg ccagcttcag ccacgccctg       900
     gccagcgagc tggcgcagct ggcggcgccc gcggcccccc tcagcctgac cataggccgc       960
     gcaggcccgg acggcgtgcc gctgctgctc tgtgtcgatg ggcaactgta cggccagacg      1020
     ctgaaggtca gccacccgga tcccgacagc ggtcgccgga tcatcgcctt cgccgccctc      1080
     gacatgctgc gccgccagct gcagggcttg cctgtgctcg gcgactaccg caccctggcc      1140
     cgcaccgcca gccgctaa                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page