(data stored in ACNUC7421 zone)

EMBL: CP000462.PE464

CP000462.PE464       Location/Qualifiers
FT   CDS_pept        complement(519702..521000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0488"
FT                   /product="HD-GYP domain"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36755"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ5"
FT                   /protein_id="ABK36755.1"
FT                   /translation="MYSPPPLTSIRLSVSLASKTMTGIKISVDRLQVGNYVSLPLGWRE
FT                   HPFLFSSFKLKNEEEIELIRRLGLKLVTIIPDKSDAPPKPLNQIQAQPVEAPDTSQRQA
FT                   EMQLEKERRIEQLQQYRRDLQQCEKQFQQSLAQVRNVMSKIQSRPLNAIGEAQELINAM
FT                   TEQLLSVDEMVLHLVSDSEDGNNLYFHSLNVSVLSMLLAKECNMSADEIRQVGMGALFH
FT                   DIGKLKIPSQILRKTEPLTKPEQNLMAQHPRYGLDLLNLAKDFPAEAKGIVLHHHEYLD
FT                   GSGPEGLKKGQLDPLTQIVSLINEYDNLCHMQAKVPYSALSGLYKQRKAQFNPEYLSML
FT                   IRLMGIYPPGSVVQLSNGQVGLVMSVNASRLLYPSVLVYDPRIPRQEAAIIDLQQAELS
FT                   IAKVIHPKRLPPAVFEYLNPRTRISYYFEHTKP"
     ttgtattcac ccccaccttt gactagcata cggctcagtg tgtctctcgc atccaagaca        60
     atgacaggta tcaagatttc agtagaccgg ctgcaagtcg gcaattacgt ttctctgcca       120
     cttggctggc gcgaacaccc cttcctgttt tccagcttca aactcaagaa tgaagaggag       180
     atcgagctca ttcgccggct cggtctcaag ctcgttacca tcatccccga caagagcgat       240
     gcgccgccca aaccgctgaa ccagatccag gcccagccgg tggaggcgcc ggatacctcc       300
     cagcgtcagg ccgaaatgca gttggagaag gagcgccgca tcgagcagct gcagcagtac       360
     cgccgcgatc tgcagcagtg cgagaagcag ttccagcagt cgctggccca ggtgcgcaac       420
     gtgatgagca agatccagtc ccgccccctc aacgccatcg gcgaggcgca ggagcttatc       480
     aacgccatga ccgagcagtt gctgtcggtg gacgagatgg tgttgcacct ggtctccgac       540
     agcgaggacg gcaacaacct ctacttccac tccctcaacg tcagcgtgct cagcatgttg       600
     ctggccaagg agtgcaacat gtcagccgac gagatccgcc aggtcggcat gggggccctg       660
     ttccacgaca tcggcaagtt gaagatcccg agccagatcc tgcgcaagac cgagccgctc       720
     accaagccgg agcagaacct gatggcccag cacccgcgct acgggctgga tctgctcaat       780
     ctggccaagg acttcccggc cgaggcgaag ggcatagtgc tgcaccacca cgaatacctg       840
     gacggcagcg ggccggaggg gctcaagaag gggcagctcg acccgctcac ccagattgtg       900
     tcgctgatca acgagtacga taacctctgc cacatgcagg ccaaggtgcc ctactcggcc       960
     ctgagcggcc tctacaagca gcgcaaggcc cagttcaatc cggagtatct cagcatgctg      1020
     atccggctga tggggatcta cccgcccggc agcgtggtgc agctctccaa cggccaggtg      1080
     gggctggtga tgtcggtcaa cgcctcccgc ctgctctacc cctcggtgct ggtgtacgat      1140
     ccgcgcatcc cgcgccagga ggcggccatc atcgacctgc agcaggccga gctctccatc      1200
     gccaaggtga tccatcccaa acggctgccg ccggcggtgt ttgagtacct caacccgcgc      1260
     acccgcatca gctactactt cgaacacacc aagccctga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page