(data stored in ACNUC7421 zone)

EMBL: CP000462.PE466

CP000462.PE466       Location/Qualifiers
FT   CDS_pept        complement(522047..522619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0490"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39697"
FT                   /db_xref="GOA:A0KFJ7"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR022778"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ7"
FT                   /protein_id="ABK39697.1"
FT                   /translation="MAHSKTGSSPACLAIAGVIRIFMHPSHPFWSQEVPRVDGQLLLTP
FT                   CPGTQQVALPLALGQLKLAGAHGVLTLMTDAELARLELGRLGQQIEAAGMRWFQLPIED
FT                   DQAPDAAFEAAWQQTLPDLIGLLRDGKHLVIHCKGGSGRTGLVAAALLMSLGQPQQEAM
FT                   AAIRAHRPKAFTLACHRQWLDGLAEGD"
     ttggcgcact caaaaaccgg gtcaagcccg gcttgcctcg ccattgctgg cgtcataagg        60
     atctttatgc acccgtctca ccccttctgg agccaggaag tcccccgcgt cgatggtcag       120
     ctgctgctga ccccctgccc cggcacccag caggtggcgc tgccgctggc actgggccag       180
     ctcaagctgg ccggggcgca cggcgtgctg accctgatga ccgatgccga actggcccgg       240
     cttgaactgg gcaggcttgg ccagcagatc gaggccgccg gcatgcgctg gttccagctg       300
     cccatcgagg acgatcaggc tcccgatgcc gccttcgagg ccgcctggca gcagacactg       360
     ccagacctca tcggattgct gcgggacggc aagcacctgg tcatccactg caagggcggc       420
     agcggccgca ccgggctggt ggcggcggcc ctgctgatga gcctgggcca gccccagcag       480
     gaggcgatgg ccgccatccg ggcccatcgc cccaaggcct tcaccctggc ctgccaccgc       540
     cagtggctcg acgggctggc cgagggcgac tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page