(data stored in ACNUC7421 zone)

EMBL: CP000462.PE468

CP000462.PE468       Location/Qualifiers
FT   CDS_pept        complement(523241..525205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0492"
FT                   /product="sulfatase"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38012"
FT                   /db_xref="GOA:A0KFJ9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFJ9"
FT                   /protein_id="ABK38012.1"
FT                   /translation="MTTIRRWLGPFWPIAVFSLIALVSLSISRLALGLWQLERVDAVAG
FT                   WQEMLLQGLRVDFATLCWLWGVPAVFTLLLAGPHAVGRAWLQFIRVWLTLGLWLLLFLE
FT                   ISTPSFVTEYGVRPNRLYIEYLIYPKEVFAMLWAGRKGELLLALLFSGAVLAGGWWLSG
FT                   RLLRGISFPRWYWRPAFALLILAIGFLGARSSLGHRALNPAMVAFASDPLVNALTVNSS
FT                   YSLFFAIKQMRAEEDASQFYGELPRQRILDLVRQESGRESHEFSSDTLPSQTFNEASYG
FT                   GKPKNLVILLQESLGAQFVGSLGGLPLTPNIDALSKEGWAFEQLYATGTRSVRGIEAVL
FT                   TGFTPTPAQAVVKLGRSQTNFFTIADLLKQRGYDTSFIYGGESHFDNMRSFFLGNGFTT
FT                   IVEQKDFKNPVFEGSWGASDEDLMAKADETFQALSKQGKPFFSLVFSSSNHDPFEFPDD
FT                   RIALYEQPKQTRNNAAKYADYAIGEFFKKAKQSDYWKDTLFLVIADHDSRVSGASLVPI
FT                   PRFHIPGVIVGDGIAPRQDPRIVSQIDMAPTLLSLMGISADYPMLGKDLTRMPADWPGR
FT                   AIMQYDKNFALMRGKDVVILQPERAPEGFIYEDATETLTPAPQPATMKDAALGLALWGS
FT                   LAYQQGLYRTAPDTRTVLN"
     atgaccacta tcagacgatg gctgggaccg ttttggccca tcgccgtttt ttcattgatc        60
     gcgctagtct ctctctccat cagccggctc gcgctcggcc tctggcagct ggagcgggtc       120
     gacgccgtcg ccggctggca ggagatgctg ctgcaggggc tgcgggtcga cttcgccacc       180
     ctctgctggc tgtggggcgt gcccgccgtg ttcaccctgc tgctggccgg cccccatgcc       240
     gtgggccgtg cctggctgca gttcatccgg gtctggctga ccctggggct ctggctgctg       300
     ctcttcctgg agatctccac cccctccttc gtgaccgagt acggggtgcg gcccaaccgc       360
     ctctacatcg aatacctcat ctatcccaaa gaggtgttcg ccatgctgtg ggccggccgc       420
     aaaggcgagc tgctgctggc actgctgttc agcggcgccg tgctggcggg cggctggtgg       480
     ctgagcggcc gcttgctgcg cggcatcagc ttcccgcgct ggtactggcg gcccgccttc       540
     gccctgctga tcctggccat cggttttctc ggtgcccgct ccagcctggg tcaccgcgcc       600
     ctcaacccgg ccatggtggc gtttgccagc gatccgctgg tcaatgcgct caccgtcaac       660
     tcctcctact ccctgttctt cgccatcaag cagatgcggg ccgaggagga tgccagccag       720
     ttctacggcg agctgccccg ccagcgcatt ctggatctgg ttcgccagga gagcgggcgt       780
     gaatcccacg aattcagctc cgacaccctg cccagccaga ccttcaacga ggccagctac       840
     ggcggcaagc cgaagaacct ggtgatcctg ctgcaggaga gcctgggcgc ccagttcgtc       900
     ggctccctcg gcggcctgcc gctcaccccg aacatcgatg ccttgtcgaa agagggttgg       960
     gcgttcgagc agctctacgc caccggtacc cgctcggtgc gcggcatcga ggcggtgctg      1020
     accggcttca cgccgacccc ggcccaggcc gtggtcaagc taggccgcag ccagaccaac      1080
     ttcttcacca tcgccgatct gctcaagcag cggggctacg acaccagctt catctacggc      1140
     ggcgagagcc acttcgacaa catgcgcagc ttcttcctcg gcaacggctt caccaccatc      1200
     gtcgagcaga aggacttcaa gaacccggtg ttcgagggct cctggggcgc ctctgacgaa      1260
     gatctgatgg ccaaggccga cgagaccttc caggcactca gcaagcaggg caagcctttc      1320
     ttcagcctgg tgttcagctc gagcaaccac gatccgttcg agtttcccga cgatcgcatc      1380
     gccctctacg agcagcccaa gcagacccgc aacaacgccg ccaagtacgc ggactacgcc      1440
     atcggcgagt tcttcaagaa ggcgaagcag tcagactact ggaaagacac cctgttcctg      1500
     gtcatcgccg atcacgacag ccgggtcagc ggcgccagcc tggtgcccat cccccgcttc      1560
     cacattccgg gcgtcatagt gggtgacggc atagcgccga gacaggatcc gcgcatcgtc      1620
     agccagatcg acatggcgcc gaccctgctc tccctgatgg ggatcagcgc cgactacccc      1680
     atgctcggca aggatctgac ccgcatgccc gccgactggc cgggccgcgc catcatgcag      1740
     tacgacaaga acttcgccct gatgcgcggc aaggacgtag tgatcctgca gcctgagcga      1800
     gcgccggaag gcttcatcta tgaggatgcg acagagacgc tcaccccggc gccgcagccg      1860
     gccaccatga aggatgccgc cctcggcctg gcgctgtggg gcagcctcgc ctaccagcag      1920
     gggctttacc ggacggcgcc ggatacccgc accgtgctga actga                      1965
//

If you have problems or comments...

PBIL Back to PBIL home page