(data stored in ACNUC7421 zone)

EMBL: CP000462.PE471

CP000462.PE471       Location/Qualifiers
FT   CDS_pept        528005..529678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0495"
FT                   /product="glycosidase"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38833"
FT                   /db_xref="GOA:A0KFK2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK2"
FT                   /protein_id="ABK38833.1"
FT                   /translation="MAPVWRFGRRYHHSGNITMKQGTLRHGGLIGAALLLTACGSGGGS
FT                   GSSEPQQPPVTNPPPATASRACYGNDQPACNLRTYQVMVESFVDGDGSANYGVGYGPSQ
FT                   HNGDLQGIIDSLDHIKSLNVNAIWLTPVFDSCAGQGGDDKLDATGYFACDFFNVDPNFG
FT                   SNVQLKQLVDGAHQRGLYVFLDGVFGHVNKVGVSKPSPEGRLPALKSGGAGYPGQLVDY
FT                   SQPQSLAYFKEVARYWVEQYGIDGWRLDQAYQLGLDDWRAIRSEVERASAARKTAGQQW
FT                   GTLGYMVGEVWKGADEIRAQAYGPSDNPALSSAFDFPLRYGLVQALAVEESGKGGQGAS
FT                   VLDASWNKVENYPNHAMPNLMLGNHDLVRFGDLLERGNFNPADYWQRHKAAFSFLAARS
FT                   GPITLYYGEEFGDEVPGFAKQVGGDCAAQGLCDDHVARSDGKVPGATGFVPSSEQSELK
FT                   QWLSQLLALRAAHPALYQGERVKLVAEGSVYGDIKQTAAEQVVYLLNVSSTPQSYAVPV
FT                   GKLRSASALVDLQSGESLAIGGSSVTVDLPPLSGRFLLVR"
     atggccccag tgtggcgctt tgggcgccga taccaccaca gcgggaacat aacaatgaaa        60
     caaggaacgt tgcgccatgg cggccttatc ggggccgccc tgttattgac ggcttgcggc       120
     agcggaggcg ggagcggctc cagcgagccc cagcagcccc cggtcaccaa cccgccgccg       180
     gccaccgcca gccgcgcctg ctacggcaat gatcagccgg cctgcaacct gcgcacctat       240
     caggtgatgg tagagtcgtt cgtcgacggc gacggcagcg ccaactacgg tgtcggctat       300
     ggcccctccc agcacaacgg cgatctgcag gggatcatcg acagcctgga ccacatcaag       360
     agcctcaacg tcaacgccat ctggctgacc ccggtgttcg actcctgcgc ggggcaaggc       420
     ggtgacgaca agctggatgc caccggctac ttcgcctgcg acttcttcaa cgtggatccc       480
     aacttcggca gcaacgtcca gctcaagcag ctggtggacg gagcgcatca gcgcggcctc       540
     tacgtcttcc tcgacggggt gttcggccac gtcaacaagg tgggggtgag caagccttct       600
     cccgaaggac ggctgcccgc cctcaagagc ggcggggccg gttatcccgg ccagctggtg       660
     gattacagcc agccccagag cctcgcctac ttcaaggagg tggcccgcta ctgggtcgag       720
     cagtacggca tcgacggctg gcgcctcgat caggcttatc agctcggcct cgacgactgg       780
     cgcgccattc gcagcgaagt ggagcgggcc agcgcggcgc gcaagacagc cggccagcag       840
     tggggcaccc tcggctacat ggtgggcgag gtgtggaagg gcgccgacga gatccgcgcc       900
     caggcgtatg ggccgagcga caacccggcg ctctcctcgg cgttcgactt cccgctgcgc       960
     tacggtctgg tgcaggcgct ggcggtggag gagtccggca agggcgggca gggggccagc      1020
     gtgctcgacg ccagctggaa caaggtggag aactacccga accacgccat gcccaacctg      1080
     atgctgggca accacgatct ggtgcgcttc ggcgatctgc tggagcgcgg caacttcaat      1140
     ccggcggact actggcagcg tcacaaggcg gccttcagct tcctggcggc ccgctccggc      1200
     cccatcaccc tctactacgg cgaggagttt ggcgacgagg tgccgggctt tgccaagcag      1260
     gtggggggcg actgcgccgc gcaggggctg tgcgatgatc acgtggcccg cagcgatggc      1320
     aaggtgccgg gtgccaccgg ctttgtgccg agcagcgagc agagcgagct gaaacagtgg      1380
     ctcagtcagc tgctggccct gcgcgccgcc caccccgccc tctatcaggg ggagcgggtc      1440
     aagctggtag ccgagggcag cgtctatggc gacatcaagc agacggcggc ggagcaagta      1500
     gtctacctgc tcaacgtctc aagcacgccc cagagttacg cggtgccagt cggcaagctg      1560
     cgcagtgcca gcgccctggt ggatctgcag agcggcgaga gcctggccat cggcggcagc      1620
     agcgtgacgg tggatttgcc gccgctgagc ggccgcttcc tgctggtgcg ctaa            1674
//

If you have problems or comments...

PBIL Back to PBIL home page