(data stored in ACNUC7421 zone)

EMBL: CP000462.PE472

CP000462.PE472       Location/Qualifiers
FT   CDS_pept        complement(529733..530263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0496"
FT                   /product="putative transporter, putative Mg2+ transporter-C
FT                   (MgtC) family"
FT                   /note="identified by match to protein family HMM PF02308"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37155"
FT                   /db_xref="GOA:A0KFK3"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK3"
FT                   /protein_id="ABK37155.1"
FT                   /translation="MTTDWWDIAPLGWENILVCLVCGTLVGLERQLRGKPVGIRTSSLI
FT                   ILGTYCFLAIGAAVSPQSADQARVLGQLITGIGFLGAGVMMTRDGQVLGVTSAATVWML
FT                   AALGALIGMQMLHQALLLTGVTLSILVGVDYLETSFKSLRRGVHNRLESWRHGNGNVQA
FT                   APHQDELGSGIEK"
     atgacgactg attggtggga catagcgccc cttggctggg agaacatcct ggtctgtctg        60
     gtgtgcggca ccctggtggg gctggagcgg cagctgcgcg gcaagccggt cggcatccgc       120
     acctcctcgc tcatcatcct cggcacctac tgctttctcg ccatcggtgc cgccgtcagc       180
     ccccagagcg ccgatcaggc gcgggtgctg ggccagctca tcaccggcat cggctttctc       240
     ggcgccgggg tgatgatgac ccgggatggt caggtactgg gggtcacctc cgccgccacc       300
     gtctggatgc tggccgccct cggcgccctc atcggcatgc agatgctgca ccaggcgctg       360
     ctgctcaccg gcgtcaccct ctccatcctg gtgggggtgg actacctgga gaccagcttc       420
     aagagcctgc gccgcggagt ccacaaccgg ctggagagct ggcgccacgg caatggcaac       480
     gtgcaggctg ccccccatca ggacgaactc ggcagcggca tcgagaagta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page