(data stored in ACNUC7421 zone)

EMBL: CP000462.PE473

CP000462.PE473       Location/Qualifiers
FT   CDS_pept        complement(530291..531733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37004"
FT                   /db_xref="GOA:A0KFK4"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR025839"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFK4"
FT                   /protein_id="ABK37004.1"
FT                   /translation="MSTYVIVEEPGDWPCHADYLLTARTYLQHGVPTTGGRPRIINLCR
FT                   NLEHLSAGYYCSLLAQARGHHCLPGLQAISQLQPQQPPAKLWRKLQGWLAQQSEDRIRV
FT                   RAIFGQCEQSELAGLARYYYGLSQLPLQELTLKRGRHGWSVRQQQSLSPLELSTSEKEL
FT                   MLHHAQALVGTGDEEQAAPLYQLAILVDPNDGRASSDALALERFIQAAAAQGIRAEILA
FT                   PSAIERLPEFDTLWLRSETAVGHYTFEFARRAEQLKMPVIDSSRAILACSNKLYLYELM
FT                   VRSGVPMPPTMVVTRRGRHHVDELVQRLGLPLMVKVPDGAQGRDLAMASDEQQLARLLD
FT                   EGLARSALLLVQSRIPAEFDWRIGFLDGSPLFACRRFRPEPGNRIRRRKHPLDMSRIEA
FT                   LPLNEVPERVLQTARRAVHQLGNGLFGVDLRQQGRDCVLLEIIDNPWIRGDIEDREAKD
FT                   LYERLARAFRQRLENRGQSAAG"
     atgagtacct acgtcatcgt cgaagagccg ggcgactggc cctgccatgc cgattatctg        60
     ctgaccgccc gcacctacct gcaacacggg gtgcccacca ccggcggccg cccccgcatc       120
     atcaacctct gccgcaatct ggagcacctc agtgccggct actactgctc gctgctggcc       180
     caggcccgcg gccaccactg cctgccgggt ctgcaggcca tcagccagct gcaaccccag       240
     cagccgccgg ccaagctgtg gcgcaagctg cagggctggc tggcccagca gagtgaagac       300
     cgaatccggg tgcgcgccat cttcggccag tgcgaacaga gcgagctggc gggactggcc       360
     cgctactact acggcctcag ccagctgccg ctgcaagagc tgaccctcaa gcgcggccgc       420
     cacggctggt cggtgcgcca gcagcagagc ctatcaccgc tggaactgag cacgagcgag       480
     aaagagttga tgctgcacca cgcccaggca ctggtgggca ccggcgacga ggagcaggcg       540
     gcgccgctct atcagctcgc cattctggtc gaccccaacg acggccgcgc cagcagcgat       600
     gcgctggcgc tggagcgctt catccaggcg gccgcggcgc aggggatccg ggccgagatc       660
     ctggcgccgt ccgccatcga acggctgccg gagttcgaca ccctctggct gcgctccgaa       720
     accgcggtgg gccactacac cttcgaattt gcccgccgcg ccgagcagct caagatgccg       780
     gtgatcgaca gctcccgcgc catcctcgcc tgcagcaaca agctctacct ctacgagctg       840
     atggtgcgca gcggcgtgcc catgccgccc accatggtgg tgacccgccg cggccgccac       900
     cacgtggacg agctggtgca gcggctcggc ctgccgctga tggtgaaggt gcccgacggg       960
     gcgcaggggc gcgatctggc catggccagc gacgagcagc aactggcccg cctgctggat      1020
     gaggggctgg cccgctccgc cctgctgctg gtgcagagcc ggatccccgc cgagttcgac      1080
     tggcgcatcg gctttctcga cggctcgccg ctgtttgcct gccgccgttt ccgccccgag      1140
     cccggcaacc gcatccgccg ccgcaagcac cccctcgaca tgagccgcat cgaggcactg      1200
     ccgctcaacg aggtgccgga gcgggtgctg caaaccgccc gccgcgcggt ccatcagctc      1260
     ggcaacggcc tgttcggggt cgatctgcgc cagcaggggc gtgactgcgt gctgctggaa      1320
     atcatcgaca atccctggat acgtggcgat attgaggaca gagaggcaaa ggacctctac      1380
     gagcgcctcg cccgggcctt ccgccagcgg ctggagaacc gggggcagag cgcggccgga      1440
     taa                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page